KEGG   Rattus norvegicus (rat): 29221Help
Entry
29221             CDS       T01003                                 

Gene name
Arg1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
rno05146  Amoebiasis
Module
rno_M00029  Urea cycle
rno_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    29221 (Arg1)
   00330 Arginine and proline metabolism
    29221 (Arg1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    29221 (Arg1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     29221 (Arg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 29221
NCBI-ProteinID: NP_058830
RGD: 2150
Ensembl: ENSRNOG00000013304
UniProt: P07824
Structure
PDB: 

Position
1p12
AA seq 323 aa AA seqDB search
MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPN
DSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALT
LSCFGTKREGNHKPETDYLKPPK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaagccaaagcccatagagattatcggagcgcctttctctaagggacagcct
cgaggaggggtagagaaaggtcccgcagcattaaggaaagctggcctggtggagaagctt
aaagaaacagagtacaatgtgagagaccacggggatctggcctttgtggatgtccccaat
gacagcccctttcaaattgtgaagaacccacggtctgtgggaaaagccaatgaacagctg
gctgctgtggtagcagagacccagaagaatggaacaatcagtgtggtgctgggtggagac
cacagtatggcaattggaagcatctctggccacgccagggtccaccctgacctatgcgtc
atttgggtggatgctcacactgacatcaacactccgctgacaaccagctctgggaatctg
cacgggcaaccggtggcctttctcctgaaggaactgaaaggaaagttcccagatgtacca
ggattctcctgggtgaccccctgcatatctgccaaggacatcgtgtacatcggcttgcga
gatgtggaccctggggaacactatataataaaaactctgggcattaagtatttctcaatg
actgaagtggacaagctgggaattggcaaagtgatggaagagaccttcagctacctgctg
ggaaggaagaaaaggcccattcacctgagttttgatgttgatggactggacccagtattc
accccggctacgggcacacccgttgtgggaggcctatcttacagagaaggtctctacatc
acagaagaaatttacaagacagggctactttcaggactagatatcatggaagtgaaccca
actcttgggaagacaccagaggaggtgactcgtactgtgaacacggcagtggcgttgacc
ttgtcttgttttggaacgaaacgggaaggtaatcataagccagagactgactaccttaaa
ccaccgaaataa

DBGET integrated database retrieval system