KEGG   Rattus norvegicus (rat): 29223Help
Entry
29223             CDS       T01003                                 

Gene name
Ak4, AK_4, Ak3l1, Ak3l2
Definition
(RefSeq) adenylate kinase 4
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00730  Thiamine metabolism
rno01100  Metabolic pathways
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    29223 (Ak4)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    29223 (Ak4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29223 (Ak4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     29223 (Ak4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29223 (Ak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 Cytidylate_kin AAA_33 Thymidylate_kin AAA_28 AAA CoaE AAA_22 AAA_16 ABC_tran AAA_5
Motif
Other DBs
NCBI-GeneID: 29223
NCBI-ProteinID: NP_058831
RGD: 2078
Ensembl: ENSRNOG00000045738
UniProt: Q9WUS0
Position
5q33
AA seq 223 aa AA seqDB search
MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTNTEVGDVAKQYLEK
GLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDRICDVDLVISLNIPFETLK
DRLSRRWIHPSSGRVYNLDFNPPQVLGVDDITGEPLVQQEDDKPEALAARLRRYKDAAKP
VIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaactcctgcgcgcagtcatcctggggccgcctggctctggcaagggcacg
gtatgcgaaaggatcgcccagaactttggcctccagcatctctccagcggccacttgttg
cgggagaacctaaagaccaacacggaagttggtgacgtggcaaaacagtacctagaaaaa
ggtcttttggttccggaccatgtgatcacgcgcctaatgatgtcagaactggagacccgg
agtgcccagcactggctattagatggattcccaaggacattagtgcaggcagaagctctg
gacagaatctgtgatgtggacctagtaatcagtttgaatattcctttcgagacacttaaa
gatcgtctgagccgacggtggattcacccttccagcgggagggtctataacctagacttc
aacccacctcaagtgctgggggttgatgacatcaccggcgagcctcttgtccaacaggaa
gatgataaacctgaagcacttgctgcccggctaagacggtacaaggacgcagcaaaacca
gtcatcgaactgtacaagagccgtggagtgctccaccagttttctgggacggagactaac
agaatctggccttatgtttacacgctcttctccaacaagatcacacccattcaatccaaa
gaagcctactga

DBGET integrated database retrieval system