KEGG   Rattus norvegicus (rat): 292264Help
Entry
292264            CDS       T01003                                 

Gene name
Myct1
Definition
(RefSeq) myc target 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_target_1
Motif
Other DBs
NCBI-GeneID: 292264
NCBI-ProteinID: NP_001099677
RGD: 1311467
Ensembl: ENSRNOG00000018858
Vega: OTTRNOG00000001367
UniProt: D3ZUL5
Position
1q11
AA seq 188 aa AA seqDB search
MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSP
TRRPRSSYNHGLSRTGFYRHSGCERRSNLSLASLTFQRQASLELANSFPRKSSFRASTFH
PFLQCPPLPVETESQLMTLPASTTPSTISTVHSPSRPDFRWSSNSLRMGLSTPPPPAYES
IIKAFPDS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggctaataacaccacgagtttagggagtccttggccagaaaacttttgggaggacctt
ataatgtccttcactgtatctgtggctattgggctcgcaattggaggatttctctgggcg
ctgttcgtttttctgtcgcgaagaagaagagccagtgcgcccatctcacagtggagtcct
accaggagacccaggtcttcctacaaccacggcctcagcaggacagggttctaccgccac
agtggctgtgaacggagaagcaacctcagcctggccagcctcactttccagagacaagct
tccctagagctggcaaattccttccccaggaaatcaagcttcagggcttcgactttccat
cccttcctgcaatgcccaccacttcccgtggaaaccgagagtcagctgatgactctgcct
gcctccaccaccccatccaccatcagcaccgtacacagtccgagccggccagacttccgc
tggtccagcaacagtttgcggatgggcctttccacaccacccccacctgcctatgaatcc
atcataaaggcatttcccgattcctga

DBGET integrated database retrieval system