KEGG   Rattus norvegicus (rat): 292301
Entry
292301            CDS       T01003                                 

Gene name
T
Definition
(RefSeq) T brachyury transcription factor
  KO
K10172  brachyury protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    292301 (T)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   T-box
    292301 (T)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 292301
NCBI-ProteinID: NP_001099679
RGD: 1310141
Ensembl: ENSRNOG00000012229
UniProt: D4A4W8
Position
1q12
AA seq 436 aa
MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVGLEESELWLRFKELTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNDHKDVMEEPGDCQQPG
YSQWGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYPTLRNHRSSPYPSPYAHRNNS
PTYADNSSACLSMLQSHDNWSSLGVPAHTSMLPVSHNASPPTGSSQYPSLWSVSNGTITP
GSQTAGVSNGLGAQFFRGSPAHYAPLTHTVSAATSSSSGSPMYEGAATVTDISDSQYDTA
QSLLIASWTPVSPPSL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagctccccgggcacagagagcgcagggaagagcctgcagtaccgagtggatcacctg
ctcagcgccgtggagagcgagctgcaggcgggcagcgagaagggcgaccccaccgaacgt
gaactgcgagtgggtctggaagagagcgagctgtggctgcgcttcaaggagctaactaat
gagatgattgtgaccaagaacggcaggaggatgttcccggtgctgaaggtaaatgtgtca
ggtctggaccccaatgccatgtattccttcctgctggacttcgtggcggctgacaaccac
cgctggaagtatgtgaatggggagtgggtacctgggggcaaaccagagcctcaggcgccc
agctgcgtctacatccacccagactcgcccaatttcggggcccactggatgaaggcccct
gtgtctttcagcaaagtcaaactcaccaacaaactcaatggaggaggacagatcatgttg
aactccttgcataagtacgaacctcggattcacatcgtgagagttgggggcccgcaacgc
atgatcaccagccactgctttcccgagacccagttcatagcagtgactgcctaccagaat
gaggagattacggcccttaaaattaaatacaacccgtttgctaaagccttccttgatgca
aaagaaagaaatgaccacaaagatgtaatggaggagccaggggactgccagcagccggga
tattcccaatgggggtggcttgttcctggagctggcaccctctgtccacctgccagctcc
catcctcagtttggaggttcgctctctctcccctccacacatggctgtgagaggtacccg
actctgaggaaccaccggtcatcgccctaccccagcccttatgctcatcggaacaactct
ccaacctatgccgacaattcatctgcatgcctgtccatgctgcagtcccatgacaactgg
tctagcctcggagtgcctgcccacaccagcatgctgcccgtgagtcataatgccagccca
cctactggctctagccagtaccccagcctctggtctgtgagcaatggtaccatcacccca
ggctcccagacagctggggtgtccaacgggctgggagcccagttctttagaggctcccct
gcacactacgcacccctgacgcacacggtctcagccgccacgtcctcatcctctggctcc
ccgatgtatgaaggggctgctaccgtcacagacatttctgacagccagtatgacacagcc
caaagccttctcatagcctcgtggacacctgtgtcgcctccatccctgtga

DBGET integrated database retrieval system