KEGG   Rattus norvegicus (rat): 292325
Entry
292325            CDS       T01003                                 

Gene name
B3gnt6
Definition
(RefSeq) acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
  KO
K00739  acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase [EC:2.4.1.147]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    292325 (B3gnt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    292325 (B3gnt6)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.147  acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
     292325 (B3gnt6)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   292325 (B3gnt6)
SSDB
Motif
Pfam: Galactosyl_T Fringe
Other DBs
NCBI-GeneID: 292325
NCBI-ProteinID: NP_001099681
RGD: 1310926
Ensembl: ENSRNOG00000014471
UniProt: D3ZC66
Position
1
AA seq 392 aa
MALPCSRRSKTPKTLAFLLVGMTFVVLNQWLLQEPMREKANGSVVTPWSSEAAVLRLPLL
PAPPCAANVSVDLLDGFQELPARIQDFLRYRHCRRFPQLWDAPHKCVGPRGVFLLLAVKS
SPAHYERRELIRRTWGQERSYSGQQVRRLFLVGTSSPEEAAREPQLADLLSLEAREHGDV
LQWDFKDTFLNLTLKHLHLLDWTEEHCPGMSFLLSCDDDVFVHTANVLRFLEVQSPERHL
FTGQLMAGSVPIRESWSKYFVPRQLFPGTAYPVYCSGGGFLMSRRTAQDLRRASHHVPLF
PIDDAYMGMCLQQAGLAPSNHEGIRPFGVQLPGTKRSSFDPCMYRELLLVHRFAPYEMLL
MWKALHDPALQCSHRQDAGSPEARGEMISDAH
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggctttgccctgcagtcgcaggtccaagactcccaagacactggctttccttctagtg
ggtatgactttcgtggtgctgaaccagtggctcctccaggagcccatgcgggagaaagcc
aacggttccgtggtcactccctggtcttctgaagctgctgtgctgcgtttgccgctcctc
ccggcgcccccctgcgcggccaacgtctctgtggacctcctggatggcttccaggagttg
cccgctaggatccaagatttcctgcgctaccgccactgccgccgcttcccgcagctgtgg
gacgcgccacacaaatgcgtggggccccgcggcgtcttcctgttgctggcagtgaagtcg
tcgcctgcccactacgagcggcgcgagctgatccggcgcacatggggccaggagcgcagc
tacagcggccagcaggtgcgtcgcctcttcctggtggggacctcctctccggaggaggcg
gcccgcgagcctcagctggccgatctgctgagcctggaggcgcgcgagcacggcgacgtg
ctgcagtgggacttcaaggacaccttcctcaacctcacactcaagcacctgcacctgctc
gactggacagaggagcactgcccgggaatgagcttcctgctcagctgcgacgacgacgtc
ttcgtgcacacggccaacgtgctgcgcttcctggaggtgcagtcgcccgagcgccacctc
ttcaccgggcagcttatggctggttctgtgcccatccgcgaaagctggagcaagtacttc
gtgccccgacagctcttcccaggcacagcctaccctgtgtactgcagcggcggcggcttc
cttatgtcccgccgcacagcccaggacctgcgcagagcctcacaccatgtcccgcttttc
cccatcgacgacgcctacatgggcatgtgtctgcagcaggccggcctggcacccagcaac
cacgaaggcatccggcccttcggcgtgcagctgcccggtacgaaacgctcatcctttgac
ccctgcatgtaccgcgagctgctgctggtgcaccgcttcgcgccttatgagatgctgctc
atgtggaaggcgctgcacgacccggcgctgcagtgtagccacagacaggatgcagggtct
cccgaggccagaggggaaatgatctccgatgcacactga

DBGET integrated database retrieval system