KEGG   Rattus norvegicus (rat): 29233
Entry
29233             CDS       T01003                                 

Gene name
Clcn7, ClC-7
Definition
(RefSeq) chloride voltage-gated channel 7
  KO
K05016  chloride channel 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    29233 (Clcn7)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29233 (Clcn7)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29233 (Clcn7)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel (CLC)
   29233 (Clcn7)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 29233
NCBI-ProteinID: NP_113756
RGD: 61836
Ensembl: ENSRNOG00000016976
UniProt: P51799
Position
10q12
AA seq 803 aa
MANVSKKVSWSGRDRDDEEGAPLLRRTGQPDEETPLLNGAGPGARQSHSALFRIGQMNNV
ELDDELLDPEVDPPHTFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTV
EIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKDNIDKFTEKGGLSFSLLLWATL
NSAFVLVGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGL
AVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFG
APVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVLSIYHGNMWDLSSPGLINFGR
FDSEKMAYTIHEIPVFIAMGVVGGILGAVFNALNYWLTMFRIRYIHRPCLQVIEAMLVAA
VTATVAFVLIYSSRDCQPLQGSSMSYPLQLFCADGEYNSMAAAFFNTPEKSVVSLFHDPP
GSYNPMTLGLFTLVYFFLACWTYGLTVSAGVFIPSLLIGAAWGRLFGISMSYLTGAAIWA
DPGKYALMGAAAQLGGIVRMTLSLTVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEGLY
DMHIQLQSVPFLHWEAPVTSHSLTAREVMSTPVTCLRRREKVGIIVDVLSDTASNHNGFP
VVEDVGDTQPARLQGLILRSQLIVLLKHKVFVERSNMGLVQRRLRLKDFRDAYPRFPPIQ
SIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNHNQVVGLV
TRKDLARYRLGKGGLEELSLAQT
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggccaacgtttctaagaaagtgtcttggtccggccgagatcgcgatgacgaggagggg
gcgccgctgcttcgaaggacggggcaacctgacgaggagacgccgctgctgaacggagcc
gggccgggcgcgcgccagtctcattctgcacttttccgaattggacagatgaacaacgtg
gagctggatgatgaactcctggacccggaagtggaccctcctcacaccttccccaaggag
attccacacaacgagaagctcctctccctcaagtatgagagcctggactatgacaatagt
gagaatcagctcttcctggaggaggaaagacgaatcaaccacacggctttccggacagtg
gagatcaagcgctgggttatctgtgccctcattggaatcctcacaggcctagtagcctgc
ttcattgacattgtagtggagaacctggcaggcctcaagtaccgagtcatcaaggacaac
atcgacaagttcacagagaagggcggcctgtccttctccctcctgctgtgggccacactg
aactctgccttcgtgctcgtggggtctgtgattgtggccttcatagagccagttgctgct
ggcagcggaatccctcagatcaagtgcttcctcaatggggtgaagatcccccacgtggtg
cggctcaagacgctggtgatcaaggtgtctggcgtgattctgtctgtggtagggggactg
gctgtgggaaaggaagggccaatgatccactcaggatccgtgattgctgcagggatttca
cagggaaggtcgacgtcactcaagcgagattttaagatctttgaatatttccgcagagat
acagagaagcgggattttgtctcagctggagctgcagctggagtgtctgctgcgtttgga
gcacctgtgggtggggtcctgttcagcctggaagagggcgcctccttctggaatcagttc
ctgacatggagaattttctttgcttccatgatttcgacctttacactgaattttgttctg
agcatctaccatggaaacatgtgggacctgtccagccctggcctcataaattttggaaga
ttcgactcagagaaaatggcctacacaatccatgagattcctgtcttcatcgccatgggt
gtggtgggtggcattcttggagccgtgttcaatgccttgaattactggctaactatgttt
cgaatcaggtacatccaccggccctgcctccaagtgattgaggccatgctggtggcagct
gtcacagccacagttgcatttgtcttgatttactcgtctcgagattgccagcccctgcag
gggagctccatgtcctacccactccagctcttctgtgcagatggcgaatacaactcaatg
gccgcagccttctttaacacccctgagaagagcgtcgtcagcctgttccacgacccacca
ggctcctataatcccatgactctcggcctgttcaccctggtctacttcttcctggcctgc
tggacctatggcctcacagtatctgctggtgtcttcatcccatccctgctcattggggct
gcctggggccgactctttggcatctccatgtcctacctcacaggagcagcgatctgggca
gatccgggtaaatacgccctgatgggagctgctgctcagcttggtgggatcgtgaggatg
acccttagcctgacagtcatcatgatggaggccaccagcaacgtgacctacggttttccc
atcatgttggtgctgatgactgccaagattgtgggtgatgtcttcattgagggcctctat
gacatgcacatccagctgcaaagtgtgcccttcctacactgggaagccccggtcacctca
cattcgctcactgccagggaagtaatgagcacgcctgtgacctgcctgaggaggagagag
aaggttggcatcatcgtggatgtcctaagtgacacagcgtctaatcacaatgggttccct
gtggtggaggatgtaggagacacccagccagccagactccaaggcctaatcctgcgttcc
cagctcatcgtgctcctgaagcacaaggtgtttgtggagaggtccaacatgggtttggtg
cagcggagactgaggctgaaagactttcgcgatgcctacccacgcttccccccaatccag
tccatccacgtatcccaggatgagcgggagtgcaccatggacctttctgagttcatgaac
ccttctccctacactgtgccacaggaggcatctcttcctcgagtgttcaagctgttccgg
gctctgggcctgaggcacctggtcgtagtagacaaccacaatcaggtggtcgggctggtg
accaggaaggacctagcaagataccgcctaggaaaaggaggcctagaagagctttcactg
gcccagacgtga

DBGET integrated database retrieval system