KEGG   Rattus norvegicus (rat): 29234Help
Entry
29234             CDS       T01003                                 

Gene name
Galr2, GAL2-R, GALR-2
Definition
(RefSeq) galanin receptor 2
  KO
K04231  galanin receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29234 (Galr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29234 (Galr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Galanin
    29234 (Galr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 7TM_GPCR_Srv 7TM_GPCR_Srx Flavi_capsid
Motif
Other DBs
NCBI-GeneID: 29234
NCBI-ProteinID: NP_062045
RGD: 2657
Ensembl: ENSRNOG00000061733
UniProt: O08726
Position
10q32.1
AA seq 372 aa AA seqDB search
MNGSGSQGAENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDLCTFVFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGSGSQRAKRKVTRMIII
VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAGPLVPPPALPN
CTASSRTLDPAC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatggctccggcagccagggcgcggagaacacgagccaggaaggcggtagcggcggc
tggcagcctgaggcggtccttgtacccctatttttcgcgctcatcttcctcgtgggcacc
gtgggcaacgcgctggtgctggcggtgctgctgcgcggcggccaggcggtcagcaccacc
aacctgttcatcctcaacctgggcgtggccgacctgtgtttcatcctgtgctgcgtgcct
ttccaggccaccatctacaccctggacgactgggtgttcggctcgctgctctgcaaggct
gttcatttcctcatctttctcactatgcacgccagcagcttcacgctggccgccgtctcc
ctggacaggtatctggccatccgctacccgctgcactcccgagagttgcgcacacctcga
aacgcgctggccgccatcgggctcatctgggggctagcactgctcttctccgggccctac
ctgagctactaccgtcagtcgcagctggccaacctgacagtatgccacccagcatggagc
gcacctcgacgtcgagccatggacctctgcaccttcgtctttagctacctgctgccagtg
ctagtcctcagtctgacctatgcgcgtaccctgcgctacctctggcgcacagtcgacccg
gtgactgcaggctcaggttcccagcgcgccaaacgcaaggtgacacggatgatcatcatc
gtggcggtgcttttctgcctctgttggatgccccaccacgcgcttatcctctgcgtgtgg
tttggtcgcttcccgctcacgcgtgccacttacgcgttgcgcatcctttcacacctagtt
tcctatgccaactcctgtgtcaaccccatcgtttacgctctggtctccaagcatttccgt
aaaggtttccgcaaaatctgcgcgggcctgctgcgccctgccccgaggcgagcttcgggc
cgagtgagcatcctggcgcctgggaaccatagtggcagcatgctggaacaggaatccaca
gacctgacacaggtgagcgaggcagccgggccccttgtcccaccacccgcacttcccaac
tgcacagcctcgagtagaaccctggatccggcttgttaa

DBGET integrated database retrieval system