KEGG   Rattus norvegicus (rat): 29235Help
Entry
29235             CDS       T01003                                 

Gene name
Galr3
Definition
(RefSeq) galanin receptor 3
  KO
K04232  galanin receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29235 (Galr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29235 (Galr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Galanin
    29235 (Galr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 29235
NCBI-ProteinID: NP_062046
RGD: 2658
Ensembl: ENSRNOG00000027060
UniProt: O88626 A0A140TAA9
Position
7q34
AA seq 370 aa AA seqDB search
MADIQNISLDSPGSVGAVAVPVIFALIFLLGMVGNGLVLAVLLQPGPSAWQEPSSTTDLF
ILNLAVADLCFILCCVPFQAAIYTLDAWLFGAFVCKTVHLLIYLTMYASSFTLAAVSLDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLCFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYSLASRHFRA
RFRRLWPCGRRRHRHHHRAHRALRRVQPASSGPAGYPGDARPRGWSMEPRGDALRGGGET
RLTLSPRGPQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatccagaacatttcgctggacagcccagggagcgtaggggctgtggcagtg
cctgtgatctttgccctcatcttcctgttgggcatggtgggcaatgggctggtgttggct
gtgctactgcagcctggcccaagtgcctggcaggagccaagcagtaccacagatctcttc
atcctcaacttggccgtggccgacctttgcttcatcctgtgctgcgtgcccttccaggca
gccatctacacactggatgcctggctctttggggctttcgtgtgcaagacggtacatctg
ctcatctacctcaccatgtatgccagcagcttcaccctggcggccgtctccctggacagg
tacctggctgtgcggcacccactgcgctccagagccctgcgcaccccgcgcaacgcgcgc
gccgccgtggggctcgtgtggctgctggcggctctcttttccgcgccctacctaagctat
tacggcacggtgcgctacggcgcgctcgagctctgcgtgcccgcttgggaggacgcgcgg
cggcgcgcgctggacgtggccaccttcgccgcgggctacctgctgccggtggccgtggtg
agcctggcctacggacgcacgctatgtttcctatgggccgccgtgggtcccgcgggcgcg
gcggcagcagaggcgcgcagacgggcgaccggccgggcgggacgcgccatgctggcagtg
gccgcgctctacgcgctttgctggggcccgcaccacgcgctcatcctctgcttctggtac
ggccgcttcgccttcagcccggccacctacgcctgtcgcctggcctcgcactgcctcgcc
tacgccaactcctgccttaacccgctcgtctactcgctcgcctcgcgccacttccgcgcg
cgcttccgccgcctgtggccctgcggccgtcgccgccaccgccaccaccaccgcgctcat
cgagccctccgtcgtgtccagccggcgtcttcgggccccgccggttatcccggcgacgcc
aggcctcgtggttggagtatggagcccagaggggatgctctgcgtggtggtggagagact
agactaaccctgtcccccaggggacctcaataa

DBGET integrated database retrieval system