KEGG   Rattus norvegicus (rat): 29238Help
Entry
29238             CDS       T01003                                 

Gene name
Drd3
Definition
(RefSeq) dopamine receptor D3
  KO
K04146  dopamine receptor D3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29238 (Drd3)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    29238 (Drd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29238 (Drd3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    29238 (Drd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 29238
NCBI-ProteinID: NP_058836
RGD: 2521
Ensembl: ENSRNOG00000060806
UniProt: P19020
Position
11q21
AA seq 446 aa AA seqDB search
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcacctctgagccagataagcacccacctcaactccacctgcggggcagaaaactcc
actggcgtcaaccgggcccgtccgcacgcctactacgccctgtcctactgtgctctcatc
ctagccatcatctttggcaacggcctggtatgtgctgctgtgctgagggagcgtgccctg
cagaccaccaccaactacctagtggtgagcctggctgtggccgacctgctagtggccacg
ttggtgatgccgtgggtggtgtacttggaggtgacaggtggagtctggaatttcagccgc
atttgctgtgacgtttttgtcaccctggatgtcatgatgtgtacagccagcatcctgaac
ctctgtgccatcagcatagacaggtacacagcggtggtcatgccagttcactatcagcac
ggcaccgggcagagctcctgtagacgtgtggcactcatgatcacagctgtgtgggtgctg
gcttttgctgtgtcctgccctctcctctttggtttcaacacaacaggggatcccagcatc
tgctccatctccaaccctgattttgtcatttactcttcagtggtgtccttctacgttccc
ttcggggtgactgtcctggtctatgccaggatctacatagtcctgaggcaaaggcaaaga
aaacggatcctcactcgacagaacagccagtgcatcagtatcagacctggctttcctcag
cagtcttcctgtctgaggctgcatcccattcggcagttttcaataagggccaggtttctg
tcagatgccacaggacaaatggagcacatagaagacaaacaatatccccagaaatgccag
gacccccttttgtcacacctgcagcccccctcacctggtcagacacatggggggctgaag
cgctactacagcatctgccaagacactgccttgagacacccaagcttggaaggcggggca
gggatgagccccgtggaaaggactcggaactccttgagccccaccatggcacccaagctc
agcttagaggttcgaaaactcagcaacggcaggttatccacgtccctgaggctggggccc
ctgcagcctcggggagtaccacttcgagagaagaaggccacccagatggtggtcattgtg
cttggagccttcattgtctgctggctgcccttcttcctgactcacgttcttaatacccac
tgtcaagcatgccacgtgtccccagagctttacagagccacaacgtggctaggctatgtg
aacagtgccctgaatcctgtgatctataccaccttcaatgtggagttccgcaaagccttc
ctcaagatcctgtcctgctga

DBGET integrated database retrieval system