KEGG   Rattus norvegicus (rat): 29240Help
Entry
29240             CDS       T01003                                 

Gene name
Polb
Definition
(RefSeq) DNA polymerase beta
  KO
K02330  DNA polymerase beta [EC:2.7.7.7 4.2.99.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03410  Base excision repair
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    29240 (Polb)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    29240 (Polb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29240 (Polb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    29240 (Polb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     29240 (Polb)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     29240 (Polb)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     29240 (Polb)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     29240 (Polb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f HHH_8 DNA_pol_B_thumb HHH_5 Cdd1 NTP_transf_2 HHH HHH_2 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 29240
NCBI-ProteinID: NP_058837
RGD: 3363
Ensembl: ENSRNOG00000019150
UniProt: P06766
Structure
PDB: 

Position
16q12.5
AA seq 335 aa AA seqDB search
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKLVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVKKLDPEYIATVCGS
FRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ
LPSENDENEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP
LGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgcaaggccccgcaggagaccctcaacggcggcatcacggacatgctcgtg
gaactcgcaaactttgagaagaacgtgagccaggcgatccacaagtacaatgcatacaga
aaagcagcatctgtgatagcaaagtacccacacaaaatcaagagtggagcagaagctaag
aaattgccaggagtaggaacaaaaattgctgaaaagattgatgaatttttagcaactgga
aaattgcgtaaactggaaaagattcgtcaggatgatacaagttcatccatcaacttcctg
actcgagttactggcatcgggccatctgctgcaaggaagcttgtagatgaaggaattaaa
acattagaagatctcaggaaaaatgaagataaattgaaccaccatcagcgaattgggctg
aaatattttgaggactttgaaaagagaattcctcgtgaggagatgctgcaaatgcaggac
attgttcttaatgaagttaaaaagctggatcccgagtacatcgctacagtctgcggcagt
ttccgaagaggcgcagagtccagtggagatatggacgttctgctgacccacccaaacttc
acgtcagaatcaagcaaacagccaaagttgttacatcgtgttgtggaacagttacaaaaa
gtccgtttcattacagatactctgtcaaagggtgagacaaagttcatgggtgtttgccag
cttcccagcgagaatgatgaaaacgaatatccacacaggagaatcgatatcaggttgatc
cccaaagatcagtactactgtggtgttctctacttcactggaagtgacatctttaataag
aatatgagagcgcatgccctggaaaagggcttcacaatcaatgagtacaccatccgcccc
ctgggggtcactggggttgctggggagccccttccggtggacagcgagcaggacattttc
gattacatccagtggcgctaccgggagcccaaggacaggagtgaatga

DBGET integrated database retrieval system