KEGG   Rattus norvegicus (rat): 292413
Entry
292413            CDS       T01003                                 

Gene name
Fpr3, RGD1566044
Definition
(RefSeq) formyl peptide receptor 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 292413
NCBI-ProteinID: XP_001058175
RGD: 1566044
Ensembl: ENSRNOG00000031331
UniProt: D4A8L8
Position
1q22
AA seq 351 aa
METNYSIPMSGSEVMVNDSTISRVLWILTMVVLSITFVLGVLGNGLVIWVAGFRMAHTVT
TTCYLNLALADFFFTATLPFFIISTAMEGKWPFGWFLCKLLYIIADVNGIGSIFLITLIA
LDRCICVVHPVWAQNHRTVSLARKVVIGPWIFGLILSLHIFIFISTYRVSGGDVYCVYYF
PSWGNTDEEMLNTVFIFTTALGIIKFIIIFIIPMSIVSICYGLIAVKIQRRALVNSSRAS
RVLKAVVASFFICWFPFQLVALLSLVWFKERLLNDEYKIIDMLIMPTNSLAFFNSCLNPI
LYVFFGQDFRKRLIHSLPSSLERALSEDSGQTSNTGTNSALPSANIEMMST
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaaaccaactactccattccaatgagtggatcagaagtaatggttaatgattctacc
atctccagagttctgtggatcctcacaatggtggttctgtccatcacatttgtccttggt
gttctgggtaatggactagtgatctgggtagctggattccggatggcacacactgtcacc
accacctgttatctgaatctagctttggctgacttctttttcacagcgactctaccattt
ttcatcatctcaactgctatggaaggaaaatggccttttggctggttcctgtgcaaatta
ctttatattattgcagatgtcaatggaattggaagtatcttcctgattactttaattgcc
ttggaccgctgtatttgtgtcgtgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctaggaaggtggttattggaccctggatttttggtctgattctcagtttgcacatt
tttattttcataagtacatatagagtttctggaggggatgtgtactgtgtatactacttt
ccatcctggggtaacactgatgaggaaatgttgaacacagttttcatttttacaactgct
ctagggatcatcaagttcattattatcttcataatacccatgtccattgtttccatctgc
tatggactcattgctgtcaagatccagagaagagcccttgttaattctagccgtgcttca
cgagtcctaaaggcagttgtggcttccttctttatctgttggtttccctttcaactggtt
gcccttttaagcctagtgtggtttaaagagagattgttaaatgatgagtataaaattatt
gacatgttgattatgccaaccaactcattggccttcttcaatagttgcctcaatccaata
ctctatgttttctttggccaggacttccgaaaaagactgattcattctctgccttccagt
ttggagagagccctaagtgaggactctggtcaaaccagtaatactggcaccaattctgct
ttaccttctgcaaacattgagatgatgtcaacatga

DBGET integrated database retrieval system