KEGG   Rattus norvegicus (rat): 29242
Entry
29242             CDS       T01003                                 

Gene name
Car4, Ca4
Definition
(RefSeq) carbonic anhydrase 4
  KO
K18246  carbonic anhydrase 4 [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
rno04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    29242 (Car4)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    29242 (Car4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29242 (Car4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    29242 (Car4)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     29242 (Car4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29242 (Car4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  29242 (Car4)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 29242
NCBI-ProteinID: NP_062047
RGD: 2242
Ensembl: ENSRNOG00000002916
UniProt: P48284
Position
10q26
AA seq 309 aa
MQLLLALLALAYVAPSTEDSHWCYEIQAKEPNSHCSGPEQWTGDCKKNQQSPINIVTSKT
KLNPSLTPFTFVGYDQKKKWEVKNNQHSVEMSLGEDIYIFGGDLPTQYKAIQLHLHWSEE
SNKGSEHSIDGKHFAMEMHVVHKKMTTGDKVQDSDSKDKIAVLAFMVEVGNEVNEGFQPL
VEALSRLSKPFTNSTVSESCLQDMLPEKKKLSAYFRYQGSLTTPGCDETVIWTVFEEPIK
IHKDQFLEFSKKLYYDQEQKLNMKDNVRPLQPLGNRQVFRSHASGRLLSLPLPTLLVPTL
TCLVASFLH
NT seq 930 nt   +upstreamnt  +downstreamnt
atgcagctccttcttgctctactggcgctggcttacgtggccccctctactgaagattca
cactggtgctatgagattcaagccaaggagcccaacagccattgctcagggcctgaacaa
tggactggagactgtaagaagaaccagcagtctcctatcaatattgtcactagtaagaca
aagttgaaccccagtctgacacccttcactttcgttggctatgaccaaaagaagaagtgg
gaagttaagaacaaccaacactcagtggaaatgtcgctgggggaggacatctatattttt
ggaggagatctgcccacccagtacaaggccatacagttacacctgcactggtcagaggag
tcgaacaagggttcagagcacagtattgatgggaaacattttgccatggagatgcatgtc
gtgcataagaagatgacaacaggcgataaggtgcaggactcggactccaaggacaagatt
gcggtgctggcattcatggttgaggtgggaaacgaggtaaacgagggcttccagcccctg
gtggaggcactgtccaggctctccaaaccctttacaaactccacagtgagtgagagctgc
ctgcaggatatgcttcctgaaaagaagaaactgtctgcctacttccgttaccagggctca
ctgactacaccaggctgtgatgagactgtcatctggactgtgttcgaggaacctattaag
atccataaagaccagttcctggaattctcaaaaaagctctactatgaccaagaacagaag
ttgaacatgaaggacaatgtgaggcccctgcagccactgggaaaccgccaggtgttcagg
tctcatgcctcaggacgactgctgtctttgcccctgcccactctattggtccccacactc
acctgcctggtggccagcttcctccactga

DBGET integrated database retrieval system