KEGG   Rattus norvegicus (rat): 29246
Entry
29246             CDS       T01003                                 

Gene name
Stmn3
Definition
(RefSeq) stathmin-3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Stathmin HrpF Exonuc_VII_L
Other DBs
NCBI-GeneID: 29246
NCBI-ProteinID: NP_077322
RGD: 3628
Ensembl: ENSRNOG00000013657
UniProt: Q9JHU6
Position
3
AA seq 180 aa
MASTVSAYKEKMKELSVLSLICSCFYSQPHPNTIYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPVLSSPPKRKDASLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRLAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt   +upstreamnt  +downstreamnt
atggccagcaccgtatctgcctacaaggagaagatgaaggagctatctgtgctgtcgctc
atctgttcctgcttctactcgcagcctcacccgaacaccatctaccagtatggggatatg
gaagtgaagcagctggataagcgggcctctggccagagcttcgaggtcatcctcaagtct
ccttctgacctatctccagagagccctgtgctctcttctcctcccaagaggaaggatgct
tccttggaagagctgcagaagcggctggaggcagctgaggagcggaggaagactcaggag
gctcaggtgctgaagcagctggcagagcgacgtgagcatgagcgggaggtgctgcacaag
gcgctggaagaaaacaataactttagccgcctggcggaggagaagctcaactacaagatg
gagctgagcaaggagattcgcgaggcgcacctggcggcgctgcgcgagcggctgcgtgag
aaggaactgcacgctgctgaggtgcgcaggaacaaggagcagcgggaggaaatgtctggc
taa

DBGET integrated database retrieval system