KEGG   Rattus norvegicus (rat): 292464Help
Entry
292464            CDS       T01003                                 

Gene name
Katna1
Definition
(RefSeq) katanin catalytic subunit A1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    292464 (Katna1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     292464 (Katna1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     292464 (Katna1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Vps4_C AAA_2 RuvB_N AAA_33 AAA_5 IstB_IS21 TIP49 Mg_chelatase AAA_16 AAA_7 AAA_14 TsaE AAA_22 PhoH AAA_18 ABC_tran RNA_helicase TPR_8 TPR_1 Sigma54_activat NACHT
Motif
Other DBs
NCBI-GeneID: 292464
NCBI-ProteinID: NP_001004217
RGD: 1303062
Ensembl: ENSRNOG00000014996
UniProt: Q6E0V2 Z4YNM2
Position
1p13
AA seq 493 aa AA seqDB search
MSMSLLMITENVKLAREYALLGNYDSAMVYYQGVLDQINKYLYSVKDTHLHQKWQQVWQE
INVEAKHVKEIMKTLESFKLDSTSLKAAQHELPSSEGEVWSLPVPVERRPLPGPRKRQST
QHSDPKPHSNRPGAVVRAHRPSAQSLHSDRGKAVRSREKKEQSKGREEKNKLPAAVTEPE
ANKFDSTGYDKDLVEALERDIISQNPNVRWYDIADLVEAKKLLQEAVVLPMWMPEFFKGI
RRPWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMAR
FYSPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGASENDDPSKMVMVLAA
TNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVNLASIAENMEGYSG
ADITNVCRDASLMAMRRRIEGLTPEEIRNLSREEMHMPTTMEDFEMALKKVSKSVSAADI
ERYEKWIVEFGSC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagtcttctaatgattactgagaatgtaaaattggctcgtgagtatgcattg
ctgggaaactatgactctgcaatggtctattatcagggagttcttgaccaaattaacaag
tatctatactcagtcaaagatacacacctccatcagaaatggcaacaggtttggcaggaa
ataaacgtggaagctaagcatgttaaggagatcatgaaaacactggagagctttaaactg
gacagcacttctttgaaagctgcacagcatgagcttccgtcctcggaaggagaagtctgg
tctttgccggtacctgttgaaaggagacccttaccaggacctaggaagcgccagtctact
cagcacagtgaccctaagccacacagtaaccggccaggcgcagtcgtcagagctcatcga
ccatctgcacagagtctgcacagcgacagaggcaaagctgttcgtagtcgtgaaaagaaa
gagcagagtaagggcagagaggaaaagaacaaattacctgctgcagttacagaaccagag
gcaaataaatttgatagcacggggtatgacaaggacttagtagaagctttggaaagagat
ataatttctcagaatcccaacgttcggtggtatgatattgctgatttagtagaagctaaa
aagttgcttcaggaagcagtggtgttaccaatgtggatgccagaattctttaagggcatt
aggagaccatggaaaggtgtgctgatggttggcccacctggcactggaaagaccctcctt
gctaaagcagttgccacagaatgcaagacaacgttcttcaatgtctcttcatccactctg
acttccaaatacagaggagagtctgagaagcttgtccgtcttctgtttgaaatggctcgg
ttttactccccagctaccatatttattgatgagatagattccatctgcagccgccgagga
acttctgaagagcatgaagcaagccgaagggtgaaagctgagctgctggttcagatggat
ggtgttggaggtgcctcagaaaatgacgacccttccaagatggtcatggttctggcggcc
actaatttcccatgggacatagatgaggctttaaggcgtcgtctggagaaaagaatctat
attccgttaccatcagcaaaaggcagagaagaactgttaagaataagtctacgagagctg
gaattggctgatgatgttaaccttgcaagcatagcagaaaacatggaaggctactcaggt
gcagacattaccaatgtatgcagggatgcgtccttgatggccatgagacgccgtattgag
ggtctaaccccagaagaaatccggaacctttcaagagaagaaatgcacatgcctaccacc
atggaggattttgaaatggctttaaagaaggtctccaaatcagtatcagctgcagacatt
gagagatacgagaaatggatagttgagtttggatcatgctag

DBGET integrated database retrieval system