KEGG   Rattus norvegicus (rat): 29248Help
Entry
29248             CDS       T01003                                 

Gene name
Tnni3, TnI, cTNI
Definition
(RefSeq) troponin I3, cardiac type
  KO
K12044  troponin I, cardiac muscle
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    29248 (Tnni3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29248 (Tnni3)
   04261 Adrenergic signaling in cardiomyocytes
    29248 (Tnni3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    29248 (Tnni3)
   05414 Dilated cardiomyopathy (DCM)
    29248 (Tnni3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29248 (Tnni3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     29248 (Tnni3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin Troponin-I_N Tup_N DUF919 DUF3738
Motif
Other DBs
NCBI-GeneID: 29248
NCBI-ProteinID: NP_058840
RGD: 62052
Ensembl: ENSRNOG00000018250
UniProt: P23693
Position
1q12
AA seq 211 aa AA seqDB search
MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQ
EMEREAEERRGEKGRVLSTRCQPLVLDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVT
KNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKE
DIEKENREVGDWRKNIDALSGMEGRKKKFEG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgagagcagcgatgcggctggggaaccccagccggcgcctgctcctgtccga
cgtcgctcctcggccaactaccgagcctatgccaccgagccacatgccaagaaaaagtct
aagatctccgcctccagaaaacttcagttgaagactctgatgctgcagattgcgaagcag
gagatggagcgtgaggcagaggagcgacgtggagagaagggccgcgttctgagcacgcgt
tgccagcccttggtgttggatgggctgggctttgaagagcttcaggacctatgccggcag
cttcacgctcgtgtggacaaagtggatgaagagagatacgacgtggaagcaaaagtcacc
aagaacatcactgagattgcagatctgacccagaagatctatgacctgcgtggcaagttt
aagcggcccactctccgaagagtgagaatctcagcagatgccatgatgcaggcactactg
gggacccgggccaaggaatccttggacctgagggcccacctcaagcaggtgaagaaggag
gacattgagaaggaaaaccgggaggtgggagactggcgcaagaatatcgatgcactaagt
ggaatggaaggccgaaagaaaaagtttgagggctga

DBGET integrated database retrieval system