KEGG   Rattus norvegicus (rat): 29251
Entry
29251             CDS       T01003                                 

Gene name
F2
Definition
(RefSeq) coagulation factor II
  KO
K01313  coagulation factor II (thrombin) [EC:3.4.21.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    29251 (F2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29251 (F2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29251 (F2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    29251 (F2)
   04611 Platelet activation
    29251 (F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29251 (F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29251 (F2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29251 (F2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29251 (F2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.5  thrombin
     29251 (F2)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   29251 (F2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   29251 (F2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   29251 (F2)
SSDB
Motif
Pfam: Trypsin Kringle Thrombin_light Gla Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 29251
NCBI-ProteinID: NP_075213
RGD: 61996
Ensembl: ENSRNOG00000016325
UniProt: G3V843
Position
3q24
AA seq 617 aa
MSHVRGLGLPGCLALAALASLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGLNYHGN
VSVTHTGIECQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRRE
ECSIPVCGQEGRTTVKMTPRSRGSKENLSPPLGECLLERGRLYQGNLAVTTLGSPCLAWD
SLPTKTLSKYQNFDPEVKLVQNFCRNPDRDEEGAWCFVAQQPGFEYCSLNYCDEAVGEEN
HDGDESIAGRTTDAEFHTFFDERTFGLGEADCGLRPLFEKKSLTDKTEKELLDSYIDGRI
VEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLV
RIGKHSRTRYERNVEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLP
DKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIRI
TDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNHRWYQMGIVSWGEGCDRNGKYGFYT
HVFRLKRWMQKVIDQHR
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgtcgcacgtccgcggcctgggcctacctggctgcctggctctggctgccctggctagc
ctggtacacagtcagcatgtgttcctggcccctcagcaagcactgtcgctgctccagcgg
gtccgcagagccaacagcggcttcctggaggagctccgaaagggcaacctggagcgtgag
tgcgtggaagagcagtgcagctatgaggaggcttttgaggccctggagtctccccaagac
acggatgtgttctgggccaagtacacagtgtgtgattcagtgaggaaacctcgagagacc
ttcatggactgtctagaaggtcgctgtgctatggatctgggtctgaactaccatgggaat
gtgagtgtcacccataccggcatcgagtgtcagctgtggcgaagccgctacccacacagg
cctgacatcaactccaccacccatcctggggctgacctgaaggagaacttctgccgaaat
ccagacagcagcacctcagggccctggtgctacaccacagaccctactgtgcgcagagag
gaatgcagtatccctgtctgtggtcaggagggccgtaccactgtgaaaatgactcctcgc
tcaagaggttccaaggagaatctgtcgcctccattgggagagtgcctcctcgagcgtggc
cggctgtaccaggggaacttagctgtgacaacacttgggtccccctgcctggcctgggac
agtttgccaaccaagaccctgagcaagtaccagaacttcgaccctgaggtgaaactcgtg
caaaacttctgccgcaatccagaccgggatgaggagggcgcgtggtgctttgttgcgcag
cagcctggttttgaatactgcagcctcaactactgtgatgaagcggtgggagaggagaac
catgacggggacgagtccatcgcaggacgcaccaccgacgcggagttccacaccttcttc
gatgagaggactttcggccttggggaggcagactgtggcctgcggcctttgttcgagaag
aagtccttgacagacaaaacggaaaaggagcttcttgattcttacatagatgggcgcatc
gtggagggctgggacgctgagaagggtatcgccccatggcaggtgatgctttttcggaag
agtccccaagagctgctgtgtggagccagccttatcagtgatcgatgggtcctcactgct
gcccactgcattctgtacccaccctgggacaagaacttcactgagaatgacctcctggtg
cgcattggcaagcactccagaaccagatatgagcggaatgttgaaaagatctccatgctg
gaaaagatctacatccaccccagatataactggcgggaaaacctagaccgtgacattgct
ctgctcaagctaaagaagccagtgcccttcagtgactacattcaccccgtgtgcttgcca
gacaagcagacagtaaccagtttgctccaggctggttataaagggcgggtgacaggctgg
ggcaaccttcgggagacgtggacaactaacatcaacgagatacagcccagcgtcctgcag
gtggtgaacctgcccattgtagagcgaccagtgtgcaaggcctctacccggatacgcatt
actgacaacatgttctgtgctggcttcaaggtgaatgacaccaagcgaggagatgcttgt
gaaggtgacagtgggggaccttttgtcatgaagagcccctacaaccaccgctggtaccaa
atgggtattgtctcctggggtgaaggctgtgaccggaatgggaaatatggcttctacacg
cacgtgttccgtctgaaaaggtggatgcagaaagtcattgatcagcatagatag

DBGET integrated database retrieval system