KEGG   Rattus norvegicus (rat): 29253Help
Entry
29253             CDS       T01003                                 

Gene name
Maoa, Mao
Definition
(RefSeq) monoamine oxidase A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00380  Tryptophan metabolism
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    29253 (Maoa)
   00330 Arginine and proline metabolism
    29253 (Maoa)
   00340 Histidine metabolism
    29253 (Maoa)
   00350 Tyrosine metabolism
    29253 (Maoa)
   00360 Phenylalanine metabolism
    29253 (Maoa)
   00380 Tryptophan metabolism
    29253 (Maoa)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    29253 (Maoa)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    29253 (Maoa)
   04726 Serotonergic synapse
    29253 (Maoa)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    29253 (Maoa)
   05031 Amphetamine addiction
    29253 (Maoa)
   05034 Alcoholism
    29253 (Maoa)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     29253 (Maoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Thi4 FAD_binding_2 HI0933_like Pyr_redox_3 Pyr_redox FAD_binding_3 FAD_oxidored Lycopene_cycl AlaDh_PNT_C GIDA NAD_binding_9 Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 29253
NCBI-ProteinID: NP_387502
RGD: 61898
Ensembl: ENSRNOG00000002848
UniProt: G3V9Z3
Structure
PDB: 

Position
Xq11
AA seq 526 aa AA seqDB search
MTDLEKPNLAGHMFDVVVIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHV
KWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDEMGKEIPVDAPWQARHAQEWDKMTMKDLIDKICWTKTAREFAYLFVNI
NVTSEPHEVSALWFLWYVRQCGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKL
SSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPM
GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPIAITLDDTKPDGSLPAIMGFILARKADR
LAKLHKDIRKRKICELYAKVLGSQEALYPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVEEPESKD
VPAIEITHTFLERNLPSVPGLLKITGVSTSVALLCFVLYKIKKLPC
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctggagaagcccaatctcgcaggccacatgttcgacgtagtcgtgattgga
ggcggcatctcaggattggctgctgccaaactgttgtctgaatacaaaattaatgtcttg
gttttggaagcccgggatagagttggaggaagaacatatactgtgaggaatgagcatgtc
aaatgggtagatgttggtggagcctatgtgggaccaacccagaacagaatcttacgcttg
tctaaggagctaggcatagagacctataaagtgaatgtcaatgagcgtctagttcaatat
gtcaaggggaaaacttacccattccgtggtgcattcccacctgtgtggaaccccttggca
tatttggattacaacaacctatggagaacaatggatgaaatgggaaaagagatccccgtt
gatgcaccgtggcaagcaagacacgctcaggaatgggacaagatgaccatgaaagatctc
attgataaaatctgttggacaaaaactgctcgggaatttgcgtatctttttgtgaacatt
aatgtgacttctgagcctcatgaggtatctgccctgtggttcctgtggtatgtgaggcag
tgtgggggcactgctcggatattctcagttaccaatggcggccaggaacggaaatttgta
ggtggatctggccaagtaagtgaacagataatgggtctccttggagataaagtgaagctg
agctctcctgttacttatattgaccaaacagatgacaacatcattgtagaaacactgaat
catgaacactatgagtgcaaatacgtaattagtgccatcccaccgattttgactgccaag
atccactttaaaccagagcttccacctgagagaaaccaattaattcagcgtcttccaatg
ggggctgttatcaagtgcatggtgtattacaaggaagccttctggaagaaaaaggactat
tgtggctgcatgatcattgaagatgaggaggctccaatcgccatcactctggatgacact
aaaccagatgggtcactgcctgccatcatgggcttcatacttgcccggaaagctgatcga
cttgctaaactacataaagacataaggaagaggaaaatctgtgagctgtatgccaaagtt
ctgggatctcaagaagcattatatccagtccattatgaagagaagaactggtgtgaggag
cagtactccgggggctgctacacagcctacttccctcctggtatcatgacccagtatgga
agggtgattcgccagccagtaggtaggatttactttgcaggcacagagacagcaacacag
tggagtggctacatggaaggagcagttgaagctggagaacgagcagctagagaggtgttg
aatgctctaggaaaagtcgcgaagaaggatatatgggttgaagaacccgagtccaaggat
gttccagccattgaaattacccacaccttcttagagaggaacctgccttccgtgcctggt
ctgctcaagatcactggtgtttccacttctgtggctcttctctgctttgtattgtacaag
attaagaagctcccatgctga

DBGET integrated database retrieval system