KEGG   Rattus norvegicus (rat): 292541Help
Entry
292541            CDS       T01003                                 

Gene name
Nlrp12, Nalp12
Definition
(RefSeq) NLR family, pyrin domain containing 12
  KO
K20865  NACHT, LRR and PYD domains-containing protein 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    292541 (Nlrp12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    292541 (Nlrp12)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   292541 (Nlrp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 PYRIN FISNA AAA_16 AAA_25
Motif
Other DBs
NCBI-GeneID: 292541
NCBI-ProteinID: NP_001162613
RGD: 1309415
Ensembl: ENSRNOG00000060745
UniProt: A0A0G2JW23
Position
1q12
AA seq 1054 aa AA seqDB search
MLPATAKDALHRLSTYLEELEAGELKKFKLYLGIAEELGQDKIPRGRMEMAGPLEMAQLM
VAHMGTKEAWLLALSTFERIHRKDLWERGQGEDLVRVTPSNGLCSLESQSTCLSDVSPDA
PRKDPQITYKDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLVKEHSNPIWAQQKLLETG
WEHSRTRGHQASPIQMETLFEPDEERPEPPRTVVLQGAAGMGKSMLTHKVMLDWADGRLF
QDQFDYVFYISCRELNRSHTQCSVHDLLSSCWPEHGAPLEDLIRAPDRLLFIIDGFHELH
PSFHDVQGPWCHCWEEKRPTELLLGSLIRRLLLPQLSLLITTRPCALEKLHGLLEHPRHV
EILGFSEAEREEYFYRYFHNTGQASQVFSFMRDYEPLFTMCFVPMVSWVVCTCLKQQLES
GELLRQTSRTTTAVYMFYLLSLMQPKPGTPTFKVPANQRGLVSLAAEGLWNQKILFEEED
LGKHGLDGAEVSTFLNVNIFQKGIKCEKFYSFIHLSFQEFFTAMYCALHGREAVRRALAE
YGFSERNFLAHTVRFLFGLLNEEMRCYLERNLGWTISPQVKEEALAWIQNKARSEGSTLQ
HGSLELLSCLYEIQEEDFIQQALSHFQVVVVRNLSTKMEHVVCSFCARYCRGTEVLHLYG
SAYSTGAEDGPPEPPGAQTQSTHSQERNILPDIYSAYLSATICTNSNLIELALYRNALGS
QGVRLLCQGLRHANCKLQNLRLKRCHISGSACQDLAAAIIANRNLIRLDLSGNSIGVLGL
ELLCEGLQHPMCRLQMIQLRKCLLEAAAGRALASVLSNNSHLVELDLTGNPLEDLGLKLL
CQGLRHPVCRLRTLWLKICHLGQASCEDLASTLKMNQSLMELDLGLNDLGDSGALLLCEG
LRHPDCKLQTLRLGICRLGSDACAGVASVLQVNTCLRELDLSFNDLGDRGLWLLGEGLRH
QTCRLQKLWLDSCGLTSKACEDLSSVLGISQTLNELYLTNNALGDTGVRLLCKRLRHPGC
KLRVLWLFGMDLNKVTHRRMAALRVTKPYLDIGC
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgttgccagctacagccaaggatgccctccatcgactgtccacctacctggaagaactt
gaggctggggaactgaagaaattcaaattatacctggggattgcggaggaactgggccag
gacaagatccccaggggacgaatggagatggctggtcctctggaaatggcccaattgatg
gtggcccatatggggacaaaggaggcttggcttctggctctcagcacctttgagaggatc
cacaggaaggacctgtgggagcgaggacagggagaagacctggtgagggtgactccaagt
aatggtctatgctctcttgagagccagtcaacgtgcctttcggacgtctctcctgatgct
ccaagaaaagatccccagataacctacaaagactatgtccgaaggaaattccggctaatg
gaagaccgcaatgcgcgactaggcgaatgtgtgaacttaagtcatcgttacactcggctt
ctcctagtaaaggaacactcaaatcctatctgggcacagcaaaaacttctggaaacaggg
tgggaacactccagaaccaggggccaccaggctagccctatccaaatggagaccctcttt
gagccagatgaagaacgcccggagccaccacgcacagtggtattacaaggggcagcgggg
atggggaagtccatgttgacccacaaagtgatgttggactgggccgatgggagactcttc
caagaccagttcgattatgtcttctatatcagctgcagggagttgaatagaagccacacc
cagtgcagtgtacatgacctcctctccagctgctggccagagcatggtgcacccctcgag
gacctcatccgggctcctgatcgtcttctattcatcatcgatggcttccatgagcttcat
ccctctttccatgacgttcagggtccctggtgccactgctgggaggagaaacgacccacg
gaactcctcctcggaagcctgattcggaggttgcttctgccccagctctctttgctcatc
accacacgaccctgtgcactggagaagctgcacggcttgttggaacaccctaggcacgtg
gagatcctgggcttctccgaggcagagagggaggaatatttctacagatatttccacaac
actggacaagcgagccaagtgttcagcttcatgagggactatgagcccctctttaccatg
tgttttgttcccatggtgtcctgggtggtctgcacctgcttaaagcagcagctagaaagt
ggggagcttttaagacaaacatctaggaccaccacagcggtttatatgttctaccttctg
agcctgatgcagcccaagccagggaccccaaccttcaaagtcccagccaaccagagaggc
ctggtctctctggctgcagagggcctctggaatcagaagattctcttcgaggaagaggat
cttgggaaacatggcctagatggagcagaggtctccaccttcctcaacgtgaacatattc
cagaagggcatcaagtgtgagaaattctacagcttcatccacctgagtttccaggaattc
ttcacagccatgtactgtgcactgcacggcagagaggcggtgaggagagcactggctgag
tatggtttctcagaaaggaacttcttggcccacaccgtccgctttctctttggcctcctc
aatgaagagatgagatgctacctcgagaggaatctcggctggaccatctcccctcaggtc
aaggaggaagcattggcgtggatccaaaacaaggctcgaagtgagggctccaccctgcag
catggctccctggagcttctcagctgcttgtacgagatccaggaggaagacttcatccag
caggccctgagccactttcaggtggttgttgtcagaaacctctcaacgaagatggagcac
gtggtctgctcgttttgtgcgaggtactgcagaggcacagaagtgcttcacttgtatggg
agtgcctatagtacaggcgcagaggatggcccgccagaacctccaggagcccagacgcag
tccacacactcacaggaaaggaacatccttcctgacatttacagtgcatacctctcagca
accatctgcaccaactcaaacctgatcgagctggccttgtatcgaaacgccttgggcagc
cagggcgtgaggctgctctgtcaaggcctccgacatgcaaactgcaagcttcagaacctg
aggctgaagaggtgtcacatctccggatcagcctgccaggatctcgcagcggctatcatc
gccaataggaatttaatcaggctggacctcagtggcaacagcattggagtgctaggccta
gagctgctctgtgaggggttacagcaccccatgtgtaggctgcagatgatccagctgagg
aagtgtttgctggaggctgcggctggccgagcactggcctctgttctcagcaacaactca
catcttgtagaactggatctgacaggaaaccccttggaggatttggggctgaagttactg
tgtcaagggctgaggcacccagtctgcaggctgcggaccttgtggctgaagatctgccac
cttggacaagcttcctgtgaagatctggcttctactctcaaaatgaaccagagcctgatg
gagctggacctgggtctgaatgaccttggggattctggggcgcttctgctgtgtgagggc
ctcaggcatccagattgcaaactccagaccctccggctgggcatttgccgactgggctca
gacgcgtgtgcaggggttgctagtgtgctccaggtcaacacgtgcctccgagagctggac
ctgagcttcaatgacttgggagacaggggcctgtggctgctgggggaaggactgaggcac
cagacctgcagactccagaagctctggctggacagttgcggcctcacttccaaagcatgt
gaggacctgtcttcagtcctgggaatcagtcagaccctgaatgagctttatctgaccaat
aatgctctgggggacactggtgttcgtctgctgtgcaagaggctgaggcatccggggtgc
aagcttcgtgtcctgtggcttttcggaatggacctgaacaaagtgacccacaggaggatg
gcggcacttcgagtcacaaaaccatacctagatattgggtgctaa

DBGET integrated database retrieval system