KEGG   Rattus norvegicus (rat): 29260
Entry
29260             CDS       T01003                                 

Gene name
Tlr4
Definition
(RefSeq) toll-like receptor 4 precursor
  KO
K10160  toll-like receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    29260 (Tlr4)
   04066 HIF-1 signaling pathway
    29260 (Tlr4)
   04151 PI3K-Akt signaling pathway
    29260 (Tlr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29260 (Tlr4)
  09143 Cell growth and death
   04217 Necroptosis
    29260 (Tlr4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    29260 (Tlr4)
   04620 Toll-like receptor signaling pathway
    29260 (Tlr4)
   04621 NOD-like receptor signaling pathway
    29260 (Tlr4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29260 (Tlr4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29260 (Tlr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29260 (Tlr4)
   05161 Hepatitis B
    29260 (Tlr4)
   05171 Coronavirus disease - COVID-19
    29260 (Tlr4)
   05164 Influenza A
    29260 (Tlr4)
   05162 Measles
    29260 (Tlr4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29260 (Tlr4)
   05135 Yersinia infection
    29260 (Tlr4)
   05133 Pertussis
    29260 (Tlr4)
   05134 Legionellosis
    29260 (Tlr4)
   05152 Tuberculosis
    29260 (Tlr4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    29260 (Tlr4)
   05144 Malaria
    29260 (Tlr4)
   05145 Toxoplasmosis
    29260 (Tlr4)
   05140 Leishmaniasis
    29260 (Tlr4)
   05142 Chagas disease
    29260 (Tlr4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    29260 (Tlr4)
   05321 Inflammatory bowel disease
    29260 (Tlr4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29260 (Tlr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29260 (Tlr4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    29260 (Tlr4)
   04090 CD molecules [BR:rno04090]
    29260 (Tlr4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29260 (Tlr4)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    29260 (Tlr4)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   29260 (Tlr4)
CD molecules [BR:rno04090]
 Proteins
  29260 (Tlr4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Cell surface receptors
   29260 (Tlr4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 DUF1863
Other DBs
NCBI-GeneID: 29260
NCBI-ProteinID: NP_062051
RGD: 3870
Ensembl: ENSRNOG00000010522
UniProt: Q9QX05
Position
5
AA seq 835 aa
MMPLLHLAGTLIMALFLSCLRPGSLNPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDL
SFNPLKILRSYSFSNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGS
FSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVD
LSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSN
VLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIY
NLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNR
EDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLE
ELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNS
FKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQ
LYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVN
VEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVSVLVVATVAFLIYHFYFHLILIA
GCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFQLCLHYRDFIPGVAIAANI
IQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQ
VELYRLLSRNTYLEWEDNALGRHIFWRRLKKALLDGKALNPDETSEEEQEATTLT
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgatgcctctcttgcatctggctgggactctgatcatggcattgttcctttcctgcctg
agaccaggaagcttgaatccctgcatagaggtacttcctaatattacctaccaatgcatg
gatcagaatctcagcaaaatccctcatgacatcccttattcaaccaagaacctagatctg
agcttcaaccccctgaagatcttaagaagctatagcttctccaatttctcacaacttcag
tggctggatttatccaggtgtgaaattgagacaattgaagacaaggcatggcatggctta
aaccagctctcaaccttggtactgacaggaaaccctatcaagagtttttccccaggaagt
ttttctggactaacaaatttagagaatctggtggctgtggagacaaaaatgacctctcta
gagggtttccatattggacagcttatatccttaaagaaactaaatgtggctcataatctt
atacattcctttaagttacctgaatatttttctaatctgacaaacctagaacatgtggat
ctttcttataactatattcaaactatttctgtcaaagacttacagtttctacgtgaaaat
ccccaagtcaatctctctttagacctgtctttaaacccaattgactccattcaagcccaa
gcctttcagggaattaggctccatgaattgactctaagaagtaattttaatagctcaaat
gtactgaaaatgtgccttcaaaacatgactggtttacatgtccatcggttgatcttggga
gaatttaaaaatgaaaggaatctggaaagttttgaccgttctgtcatggaaggactatgc
aatgtgagcattgatgagttcaggttaacatatataaatcatttttcagatgatatttat
aatctcaattgcttggcaaatatttctgcaatgtctttcacaggtgtacatataaaacac
atagcagatgttcctagacatttcaaatggcaatccttatcaatcattagatgtcatctt
aagccttttccaaagctgagtctaccttttcttaaaagttggactttaactaccaacaga
gaggatatcagctttggtcagttggctctgccaagtctcagatatctagatcttagtaga
aatgccatgagctttagaggttgctgttcttattctgattttggaacaaacaacctgaag
tacttagacctcagcttcaatggtgtcatcctgatgagtgccaacttcatgggtctagaa
gagctggaatacctggactttcagcactccactttaaaaaaggtcacagaattctcagtg
ttcttatctcttgaaaaacttctttaccttgacatctcttacactaataccaaaattgac
tttgatggcatatttcttggcttgatcagtctcaacactttaaaaatggctggcaattct
ttcaaagacaacaccctttcaaatgtctttacaaacacaacaaacttaacattcctggat
ctttctaaatgccaactggaacagatatctaggggggtatttgacacactctacagactc
cagttattaaacatgagtcacaacaacctactgtttctggatccatcccattataaacag
ctgtactccctcaggactcttgattgcagtttcaatcgcatagagacatccaaaggaata
ctgcaacattttccaaagagtctagccgtcttcaatctgactaataattctgttgcttgt
atatgtgaatatcagaatttcttgcagtgggtcaaggaccagaaaatgttcttggtgaat
gttgaacaaatgaaatgtgcatcacctatagacatgaaggcctccctggtgttggatttt
acgaattccacctgttatatatacaagactatcatcagtgtatcggtggtcagtgtgctt
gtggtagccactgtagcatttctgatataccacttctattttcacctgatacttattgct
ggctgtaaaaagtacagcagaggagaaagcatctatgatgcatttgtgatctactcgagc
cagaatgaggactgggtgagaaacgagctggtaaagaatttagaagaaggagtgccccgc
tttcagctttgccttcattacagggactttattcctggtgtagccattgctgccaacatc
atccaggaaggcttccacaagagccggaaagttattgtggtggtgtctagacactttatc
cagagccgttggtgtatctttgaatatgagattgctcagacatggcagtttctgagtagc
cgctctggcatcatcttcattgtccttgagaaagtggagaagtccttgctgaggcagcag
gtcgaattgtatcgccttcttagcagaaacacctacctcgagtgggaggacaatgctctg
gggaggcacatcttctggagaagactcaaaaaagccctgttggatggaaaagccttgaat
ccagatgaaacatcagaggaagaacaagaagcaacaactttgacctga

DBGET integrated database retrieval system