KEGG   Rattus norvegicus (rat): 29265Help
Entry
29265             CDS       T01003                                 

Gene name
Mcpt1, Vch
Definition
(RefSeq) mast cell protease 1
  KO
K08661  mast cell peptidase 1 [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    29265 (Mcpt1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     29265 (Mcpt1)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   29265 (Mcpt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 29265
NCBI-ProteinID: NP_058841
RGD: 3062
Ensembl: ENSRNOG00000020625
UniProt: O70500
Position
15p12
AA seq 247 aa AA seqDB search
MQALLFLMALLLPSGAGAEEIIGGVESIPHSRPYMAHLDIITERGLKDSCGGFLITRQFV
LTAAHCRGREITVTLGAHDVSKREYTQQKIKVEKQFIHKNYNFLPNLHDIMLLKLEKQVE
LTPAVDVVPLPSPSDFIHPGTLCWTAGWGRTGVKDPTSDTLREVALRIMDEEACKIYRHY
DNNFQVCVGLSTRLQTAYTGDSGGPLLCAGVVHGIVSYGHPDATPPAVFTRIAPYVPWIN
TVLRESS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccctactattcctgatggctcttctcttgccttctggagctggagctgaggag
attattggtggtgtggagtctattccacactcccgcccttacatggcccatctggacatc
atcactgagagaggtttaaaggacagctgtggtgggtttctcataacccgccaatttgtg
ctgactgctgcacactgcagaggaagagaaatcacagtcacccttggagcccatgacgtg
agcaagcgagaatacacacagcagaagataaaagtagaaaaacaattcattcataaaaat
tacaacttccttcccaatcttcatgacatcatgttactgaagcttgaaaaacaagttgag
ttgactcctgctgtggatgtagttcccctgcctagtccttctgactttattcaccctggg
acattgtgttggactgctggatgggggcgaactggagtgaaagatcctacctcagataca
ctgagagaggttgcactgagaatcatggatgaagaggcctgtaaaatctatagacattat
gacaacaacttccaggtctgcgtgggcctttccacaaggttacaaacagcatacactgga
gactctggtgggccgctactgtgtgctggtgtggtccatggtattgtatcttatgggcat
ccagatgcaacgccccctgcagtcttcacccgaatcgccccctatgtgccctggattaat
acagtcttaagggaaagtagctga

DBGET integrated database retrieval system