KEGG   Rattus norvegicus (rat): 292658
Entry
292658            CDS       T01003                                 

Gene name
Prkd2, RGD1308054
Definition
(RefSeq) protein kinase D2
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    292658 (Prkd2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    292658 (Prkd2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    292658 (Prkd2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     292658 (Prkd2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PKD family
   292658 (Prkd2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C1_2 Kdo Kinase-like zf-RING_9 ABC1 APH
Other DBs
NCBI-GeneID: 292658
NCBI-ProteinID: NP_001013917
RGD: 1308054
Ensembl: ENSRNOG00000016434
UniProt: Q5XIS9
Position
1q21
AA seq 875 aa
MAAAPSHPAGLPCSPGPGSPPPPGGSDLQSLPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAADIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGSSESLPCTAEELSRSTTDLLPRRPPSSSSS
SSSSSFYTGRPIELDKMLMSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCK
FNCHKRCATRVPNDCLGEALINGDVPMEEAADYSEADKSSLSDELEDSGVIPGSHAENAL
HASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYW
RLDCKCITLFQNNTTNRYYKEIPLSEILAVEPAQNFSLVPPGTNPHCFEIITANVTYFVG
ETPGGAPGGPSGQGTEAARGWETAIRQALMPVILQDAPSAPGHTPHRQASLSISVSNSQI
QENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEV
AILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQIL
VALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLA
PEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISSG
AIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWDQ
FVSERHGTPAEGDLGGACLPQDHEMQGLAERISIL
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggccgccgccccctcccatcccgccggactcccctgctctccggggcccgggtctcct
ccgccccccggtggctcggatctccagtctctgccacctctgctgcctcagatccctgct
ccgggatcgggggtctccttccacatccagatcggattaacacgagagtttgtgctgttg
ccggcagcttcggagttggctcatgtgaagcaactagcctgttctatcgtggaccagaag
ttcccagagtgtggcttctacggcctgtacgacaagatcctgctcttcaaacatgaccca
acatcagccaacctcctgcagctggtgcgatcagctgcagatatccaggagggcgacttg
gtggaggtggttctgtcggcctcagccaccttcgaggatttccagatccgtccgcatgct
ctcactgtgcactcgtaccgcgcaccagctttctgtgaccactgtggggagatgctgttt
ggccttgtgcgccagggcctcaagtgcgatggctgcgggctgaattaccacaaacgctgc
gccttcagcatcccgaacaactgcagtggcgctcggaagcgcagactgtcatccacgtct
ctggccagtggccattctgtgcgtctcggcagctccgagtccctaccctgcaccgccgaa
gagctgagccgtagcaccaccgacctccttcctcgccgaccaccctcgtcgtcgtcctcc
tcctcttcctcttccttctacacaggccgacccattgagctggacaagatgctgatgtcc
aaggtcaaggtgccacacaccttccttatacatagctacacacggcccaccgtttgccag
gcttgcaagaaactgctcaagggtctcttccgccagggcctgcagtgcaaagactgcaag
tttaactgtcacaaacgctgtgctacccgagtccctaatgactgcctgggggaggcgctc
atcaatggagatgtgcccatggaagaagctgctgattacagtgaggctgataagagctcc
ctctcagatgagttggaggactctggtgtcatcccaggctcccatgcagagaatgctctc
catgccagtgaggaagaggaaggcgagggaggcaaggcccagagctcgctgggctacatc
cccctgatgcgtgtggtacagtctgtgcgacacacgacccggaaatccagcaccaccctg
cgggagggctgggtggtccattacagcaacaaggacacactgaggaagcggcactactgg
cgcctagactgcaaatgcattaccctcttccagaacaacacgaccaacagatactacaag
gagatcccgctgtctgaaatcctcgcagtggagccggctcagaacttcagcctcgtacct
ccgggcaccaacccacactgctttgagatcatcaccgccaatgtcacctactttgtgggc
gagacacctggcggggccccgggagggccgagcgggcagggaacagaggctgcccggggt
tgggagacagccatccgccaggcactgatgcctgttatcctccaagatgcacccagtgcc
ccaggccacacaccacacagacaagcttctctgagcatctctgtgtccaacagtcagatc
caagagaacgtggacatcgccactgtctaccagatcttccccgatgaggtgctgggctct
ggacagtttggagtggtctatggaggaaaacacaggaagactggcagagatgttgcagta
aaggtcattgacaaactacgcttccccaccaagcaggagagccagctcaggaatgaagtg
gccatcctccagagcctgcggcaccccgggattgtgaacctcgagtgcatgtttgagacc
cctgagaaggtattcgtggtgatggagaaactgcatggggacatgttggagatgatcctc
tccagtgagaagggccggcttcctgagcgcctcaccaagttccttatcacgcagattctg
gtggcactgagacacctacacttcaagaacatcgtccactgtgacttgaaaccagagaat
gtgttactggcatcagccgatccgtttcctcaggtgaagctatgtgacttcggcttcgct
cgcatcatcggtgagaagtccttccggcgctcagtggtgggcacgcccgcctacctggca
cctgaggtactgctcaaccagggttacaaccgctcgctggacatgtggtccgtgggtgtg
atcatgtatgtgagcctcagtggcacgtttcccttcaatgaggacgaggacatcaatgac
cagatacagaatgcagcctttatgtacccggccagcccctggagccacatctcatctgga
gccatcgacctcatcaacaacctgttgcaggtgaagatgcgcaagcgctacagcgtggac
aagtctctcagccacccatggttacaggagtaccagacgtggcttgacctccgagagcta
gagggaaagatgggcgagcgatatatcacccatgagagcgacgacgcacgctgggatcag
tttgtatcagagcgccatgggacgcctgcagaaggggacctgggtggcgcctgtctgcca
caggaccatgagatgcaggggctggctgagcggatcagcatcctctga

DBGET integrated database retrieval system