KEGG   Rattus norvegicus (rat): 292658
Entry
292658            CDS       T01003                                 

Gene name
Prkd2
Definition
(RefSeq) serine/threonine-protein kinase D2
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    292658 (Prkd2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    292658 (Prkd2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    292658 (Prkd2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     292658 (Prkd2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PKD family
   292658 (Prkd2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C1_2 ABC1 Kdo Kinase-like zf-RING_9 APH
Other DBs
NCBI-GeneID: 292658
NCBI-ProteinID: NP_001013917
RGD: 1308054
Ensembl: ENSRNOG00000016434
UniProt: Q5XIS9
Position
1
AA seq 875 aa
MAAAPSHPAGLPCSPGPGSPPPPGGSDLQSLPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAADIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGSSESLPCTAEELSRSTTDLLPRRPPSSSSS
SSSSSFYTGRPIELDKMLMSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCK
FNCHKRCATRVPNDCLGEALINGDVPMEEAADYSEADKSSLSDELEDSGVIPGSHAENAL
HASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYW
RLDCKCITLFQNNTTNRYYKEIPLSEILAVEPAQNFSLVPPGTNPHCFEIITANVTYFVG
ETPGGAPGGPSGQGTEAARGWETAIRQALMPVILQDAPSAPGHTPHRQASLSISVSNSQI
QENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEV
AILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQIL
VALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLA
PEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISSG
AIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWDQ
FVSERHGTPAEGDLGGACLPQDHEMQGLAERISIL
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggccgccgccccctcccatcccgccggactcccctgctctccggggcccgggtctcct
ccgccccccggtggctcggatctccagtctctgccacctctgctgcctcagatccctgct
ccgggatcgggggtctccttccacatccagatcggattaacacgagagtttgtgctgttg
ccggcagcttcggagttggctcatgtgaagcaactagcctgttctatcgtggaccagaag
ttcccagagtgtggcttctacggcctgtacgacaagatcctgctcttcaaacatgaccca
acatcagccaacctcctgcagctggtgcgatcagctgcagatatccaggagggcgacttg
gtggaggtggttctgtcggcctcagccaccttcgaggatttccagatccgtccgcatgct
ctcactgtgcactcgtaccgcgcaccagctttctgtgaccactgtggggagatgctgttt
ggccttgtgcgccagggcctcaagtgcgatggctgcgggctgaattaccacaaacgctgc
gccttcagcatcccgaacaactgcagtggcgctcggaagcgcagactgtcatccacgtct
ctggccagtggccattctgtgcgtctcggcagctccgagtccctaccctgcaccgccgaa
gagctgagccgtagcaccaccgacctccttcctcgccgaccaccctcgtcgtcgtcctcc
tcctcttcctcttccttctacacaggccgacccattgagctggacaagatgctgatgtcc
aaggtcaaggtgccacacaccttccttatacatagctacacacggcccaccgtttgccag
gcttgcaagaaactgctcaagggtctcttccgccagggcctgcagtgcaaagactgcaag
tttaactgtcacaaacgctgtgctacccgagtccctaatgactgcctgggggaggcgctc
atcaatggagatgtgcccatggaagaagctgctgattacagtgaggctgataagagctcc
ctctcagatgagttggaggactctggtgtcatcccaggctcccatgcagagaatgctctc
catgccagtgaggaagaggaaggcgagggaggcaaggcccagagctcgctgggctacatc
cccctgatgcgtgtggtacagtctgtgcgacacacgacccggaaatccagcaccaccctg
cgggagggctgggtggtccattacagcaacaaggacacactgaggaagcggcactactgg
cgcctagactgcaaatgcattaccctcttccagaacaacacgaccaacagatactacaag
gagatcccgctgtctgaaatcctcgcagtggagccggctcagaacttcagcctcgtacct
ccgggcaccaacccacactgctttgagatcatcaccgccaatgtcacctactttgtgggc
gagacacctggcggggccccgggagggccgagcgggcagggaacagaggctgcccggggt
tgggagacagccatccgccaggcactgatgcctgttatcctccaagatgcacccagtgcc
ccaggccacacaccacacagacaagcttctctgagcatctctgtgtccaacagtcagatc
caagagaacgtggacatcgccactgtctaccagatcttccccgatgaggtgctgggctct
ggacagtttggagtggtctatggaggaaaacacaggaagactggcagagatgttgcagta
aaggtcattgacaaactacgcttccccaccaagcaggagagccagctcaggaatgaagtg
gccatcctccagagcctgcggcaccccgggattgtgaacctcgagtgcatgtttgagacc
cctgagaaggtattcgtggtgatggagaaactgcatggggacatgttggagatgatcctc
tccagtgagaagggccggcttcctgagcgcctcaccaagttccttatcacgcagattctg
gtggcactgagacacctacacttcaagaacatcgtccactgtgacttgaaaccagagaat
gtgttactggcatcagccgatccgtttcctcaggtgaagctatgtgacttcggcttcgct
cgcatcatcggtgagaagtccttccggcgctcagtggtgggcacgcccgcctacctggca
cctgaggtactgctcaaccagggttacaaccgctcgctggacatgtggtccgtgggtgtg
atcatgtatgtgagcctcagtggcacgtttcccttcaatgaggacgaggacatcaatgac
cagatacagaatgcagcctttatgtacccggccagcccctggagccacatctcatctgga
gccatcgacctcatcaacaacctgttgcaggtgaagatgcgcaagcgctacagcgtggac
aagtctctcagccacccatggttacaggagtaccagacgtggcttgacctccgagagcta
gagggaaagatgggcgagcgatatatcacccatgagagcgacgacgcacgctgggatcag
tttgtatcagagcgccatgggacgcctgcagaaggggacctgggtggcgcctgtctgcca
caggaccatgagatgcaggggctggctgagcggatcagcatcctctga

KEGG   Rattus norvegicus (rat): 313834
Entry
313834            CDS       T01003                                 

Gene name
Prkd3
Definition
(RefSeq) serine/threonine-protein kinase D3
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    313834 (Prkd3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    313834 (Prkd3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    313834 (Prkd3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     313834 (Prkd3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PKD family
   313834 (Prkd3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PH ABC1 C1_2 Kdo Kinase-like zf-RING_9 RIO1 Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 313834
NCBI-ProteinID: NP_001019434
RGD: 1310236
Ensembl: ENSRNOG00000005289
UniProt: D4A229
Position
6
AA seq 890 aa
MSANNSPPSAQKSVFPATVSAVLPTPSPCSSPKTGLSARLSNGSFSAASLTNSRGSVHTV
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHNMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPECVPLLSEES
HTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQGL
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSVGTDTDMPMDIDSNDVNSDGSRGLDDS
EEPSPPEDKMFFLDAADLDVERDEEPVKTISPSTSNNIPLMRVVQSIKHTKRKSSTVVKE
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTSISQG
SNPHCFEIITDTVVYFVGENNGNSTHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLATSISVSNCQIQENVDISSVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISSEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLEYPKHFIMAPNPDDMEEGP
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgtctgcaaataattcccctccatcagcccagaaatctgtgttccctgcaactgtttct
gctgtgcttccaaccccttctccgtgttcaagtcccaagacaggactctcagctcggctc
tctaatggcagcttcagtgccgcgtcactcacaaactctagaggctcggtgcacaccgtt
tcatttctacttcagattggcctcacacgagagagtgttaccatcgaagcccaggaactg
tctctctccgctgtcaaagacctcgtgtgctccattgtttatcagaagtttccagagtgt
ggattctttggcatgtatgataaaattcttctctttcgccacaacatgaactcagaaaac
attttgcagctgattacctcagcagatgaaatacatgaaggggatcttgtagaagttgtc
ctgtcagctttggccacagtagaagacttccagatccgccctcatgctctctatgtccat
tcttacaaagcacctactttctgtgattactgtggtgaaatgctctggggattggtacgt
caaggattaaaatgtgaaggctgtggattaaattatcataaacgatgtgccttcaagatt
ccaaataactgcagtggagtaagaaagagacgtctgtcaaatgtgtctctgccaggacct
ggcctctcagttccgagacccctgcagcctgaatgtgtgcccctgctcagtgaagagtca
catactcaccaagagccaagtaagagaatcccgtcctggagtggtcgtccgatctggatg
gaaaagatggtaatgtgcagggtcaaagttccacacacgtttgctgtccactcttatggc
cgacccacaatatgtcagtactgcaagcggctgctcaaaggcctctttcgccaaggactg
cagtgtaaagattgcaaattcaactgccacaaacgctgtgcatccaaagtaccacgagac
tgcctcggcgaagttactttcaatggagagccttccagtgtgggaactgatacagacatg
ccgatggatattgacagtaatgatgtgaacagtgatggcagtaggggcttggatgactca
gaggagccctcccctcccgaagacaaaatgttcttcctcgacgcggccgatctggatgtg
gagcgagatgaggagccggttaagacaatcagtccatccacaagcaataatatcccactg
atgagggtggtccagtccatcaagcacacaaagaggaagagcagcacagtggtgaaggaa
gggtggatggtccactacaccagcagggacaacctgagaaagagacattattggagactt
gacagcaaatgtctaacattgtttcagaatgaatctggatcaaaatattataaggaaatt
ccactttcagaaattctccgcatatcttcgccacaagatttcaccagcatttcacaaggc
agtaacccacactgttttgaaatcatcactgatactgtggtatactttgttggtgagaac
aatgggaacagcactcataaccctgttctcgctgccactggagtgggactcgatgtagca
caaagctgggaaaaagcgatccgccaggccctcatgcccgttactcctcaagcaagtgtt
tgcacttctccaggccaggggaaggaccacaaagatctggctaccagtatctccgtgtct
aactgtcagattcaggagaatgtagacatcagcagtgtttatcagatctttgccgatgag
gtgcttggttctggccagtttggcattgtttatggaggaaagcacagaaagacaggaagg
gatgtggctattaaagtaatcgataagatgcgattccccacaaagcaagagagtcagctc
cggaatgaagtggctattttacagaatctgcaccatcctgggattgtaaatctggaatgt
atgtttgaaaccccagaacgagtcttcgtagtgatggaaaagcttcatggagatatgttg
gaaatgattctgtccagtgaaaaaagtcgacttccagaacggattactaaattcatggtc
acacagatacttgttgccctgaggaatctacattttaagaatatcgtgcactgtgattta
aagcccgaaaatgtgctgcttgcatctgcagaaccttttcctcaggtgaagctatgtgac
tttgggtttgcccgcatcattggtgagaagtcgttccggaggtcagtggtgggaactcca
gcctacttagcccccgaggttctcaggagcaaaggctacaaccgttccctagacatgtgg
tcggtgggagtcatagtctatgtgagcctcagtggcaccttcccgttcaatgaagatgaa
gatataaacgaccaaatccaaaatgctgcatttatgtacccaccaaatccatggcgagaa
atctccagcgaagcaattgatttgataaacaacttgcttcaagtgaagatgagaaaacgt
tacagcgttgacaagtccctcagtcatccctggctacaggactatcagacttggcttgac
ctcagagaattcgaaactcgcattggagaacgttacatcacacatgaaagtgatgatgct
cgctgggaaatacatgcatacacgcacaatctcgaatacccaaaacatttcattatggcc
cccaacccggatgacatggaggaaggtccttag

KEGG   Rattus norvegicus (rat): 85421
Entry
85421             CDS       T01003                                 

Gene name
Prkd1
Definition
(RefSeq) serine/threonine-protein kinase D1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    85421 (Prkd1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    85421 (Prkd1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    85421 (Prkd1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     85421 (Prkd1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PKD family
   85421 (Prkd1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PH ABC1 Kinase-like C1_2 Kdo zf-RING_9 PHD
Other DBs
NCBI-GeneID: 85421
NCBI-ProteinID: NP_001263644
RGD: 620964
Ensembl: ENSRNOG00000004165
UniProt: Q9WTQ1
Position
6
AA seq 918 aa
MSAPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPV
LLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASENILQLVKIASD
IQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGL
NYHKRCAFKIPNNCSGVRRRRLSNVSLTGLGTVRTASAEFSTSAPDEPLLSPVSPGFEQK
SPSESFIGREKRSNSQSYVGRPIQLDKLLMSKVKVPHTFVIHSYTRPTVCQFCKKLLKGL
FRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGELLSPGAESDVVMEEGSDDNDSERNS
GLMDDMDEAMVQDTEMALAEGQSDGAEMQDPDADQEDSNRTISPSTSNNIPLMRVVQSVK
HTKRRSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKSITLFQNDTGSRYYKEIPLSEILCL
EPAKPSALIPTGANPHCFEITTANVVYYVGENVVNPSSPPPNNSVPPSGIGTDVARMWEV
AIQHALMPVIPKGSSVGSGTNSHKDISVSISVSNSQIQENVDISTVYQIFPDEVLGSGQF
GIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPER
VFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLL
ASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIY
VSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTL
SHPWLQDYQTWLDLRELECRIGERYITHESDDSRWEQYAGEQGLQYPAHLINLSASHGDS
PEAEEREMKALSERVSIL
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgagcgcccctccgctactacggccgcctagcccgctgctgcccgccgcggccgctgtg
gccgccgccgctgctgcgctggtcccgggctccgggcccgcgcccttcccagcgcctggg
gccgccccggcggggggcatctcgttccatctgcagatcggcctgagccgcgagccggtg
ctgctccttcaggactcctctggcgactacagcctggcgcatgtccgggagatggcttgc
tccatcgtggaccagaagttccctgaatgtggcttctatggactctatgacaagatcctg
cttttccgtcacgatcctgcctctgaaaacatccttcagctggtaaaaatcgcaagtgac
attcaggagggcgatcttattgaagtggtcctgtcagcttcagccaccttcgaagacttc
cagatccggcctcacgctctcttcgttcattcatacagagcccctgctttctgtgatcac
tgtggagaaatgctgtggggactggtgcgccaaggccttaaatgtgaaggatgtggcctg
aattaccataagagatgtgcatttaaaatccccaacaattgcagtggagtgagaaggaga
aggctctcaaatgtttccctcactggactgggtactgtccgcacagcgtctgcggagttc
tccaccagtgcccccgatgagcctctactgtctcctgtgagccctggctttgagcaaaag
tctccatctgagtcatttatcggtcgtgagaagaggtcaaattctcagtcatatgttgga
cggccgattcagctcgacaagctcctgatgtctaaggtgaaggtgccacacacctttgtc
atccactcctacacacggcccacggtctgccagttctgtaagaagctcctcaagggcctc
ttccggcagggtttgcagtgcaaagattgccgattcaactgtcacaaacgctgtgcacca
aaagtaccaaacaactgcttgggcgaagtgaccatcaatggagaattgcttagccctggg
gcagagtctgatgttgtcatggaagaagggagcgatgacaatgacagcgaacggaacagt
ggactcatggatgacatggacgaggccatggtccaggacactgagatggctttggcggag
ggtcagagtgacggtgcagagatgcaggatccagacgcagaccaggaggactccaacaga
accatcagcccttctacgagcaacaacataccgcttatgagggtagtgcagtctgtcaag
cacacaaagaggagaagcagcacagtgatgaaggaagggtggatggtccactacaccagc
aaggacacactgaggaaaaggcattactggagactggacagcaaaagcatcacactcttc
caaaacgacacaggcagccggtactacaaggaaattcctttatcagaaattttatgtctg
gaaccagcaaaaccttcagcattaattcccactggagctaaccctcattgttttgaaatc
actacagcaaacgtagtgtattatgtgggagaaaacgtggtcaacccttcaagcccccca
ccaaacaacagcgtccccccgagcggcatcggtaccgatgtggcgaggatgtgggaggtc
gccatccagcacgctctcatgcctgtcatccccaagggctcctctgtgggttccggaacc
aactcacacaaagatatttcggtgagcatttccgtttcgaatagccagattcaggaaaat
gtggatatcagcacagtctatcagattttcccggatgaggttctgggttctggacagttc
ggaattgtttatggaggtaaacatcgtaaaacaggaagagatgtagctattaagattatt
gacaaattaagatttccaacaaaacaagaaagtcagcttcgtaatgaggttgcaatttta
cagaaccttcatcaccctggtgttgtaaatttggagtgtatgtttgagacgcctgaaaga
gtgtttgttgttatggaaaaactccatggagacatgctggagatgatcctgtcaagtgaa
aagggcaggttgccagaacacataacgaagtttttaattactcagatactagtggctttg
cgacatcttcattttaaaaacatcgttcactgtgacctcaagccagaaaatgtgttgctg
gcatcagcagaccctttccctcaggtgaaactttgtgattttggttttgcccggatcatt
ggcgagaagtctttccggagatcagtggtgggtaccccagcctacctggcacctgaggtt
ctgaggaacaagggctataaccgctcgctagacatgtggtctgttggggtcatcatctat
gtgagcctgagtggcaccttcccttttaatgaagatgaagatatccacgatcagatccag
aacgcagccttcatgtatccacccaatccctggaaggagatttctcatgaagccattgat
cttatcaataacttgctacaagtgaaaatgagaaaacgctacagtgtggacaagaccttg
agtcacccctggctacaggactaccagacctggttagatttacgcgagctggaatgcaga
attggagaacgctatattacccatgaaagcgatgactcgaggtgggaacagtatgcaggc
gagcagggactgcagtatcccgcgcacctgatcaatctgagtgctagccatggcgacagt
cctgaggctgaagagagagagatgaaagccctcagtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system