KEGG   Rattus norvegicus (rat): 292661
Entry
292661            CDS       T01003                                 

Gene name
Ptgir
Definition
(RefSeq) prostaglandin I2 (prostacyclin) receptor (IP)
  KO
K04263  prostacyclin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    292661 (Ptgir)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    292661 (Ptgir)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    292661 (Ptgir)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    292661 (Ptgir)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostacyclin
    292661 (Ptgir)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 292661
NCBI-ProteinID: NP_001071112
RGD: 1310890
Ensembl: ENSRNOG00000016756
UniProt: P43253
Position
1q21
AA seq 416 aa
MVASGGRPDGPPSITPESPLIVGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGN
GLALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTML
CDTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARLALPAIYAFCCLFC
SLPLLGLGEHQQYCPGSWCFIRMRSPQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLC
HMYRQQRRHHGSFVPTSRAREDEVYHLILLALMTGIMAVCSLPLTIRGFTQAIAPDSREM
GDLHAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQTPLSRPVSGRRD
TLAPDSLQAKEGNWVPLSTWGTGQVAPLTAVPLSGGDGCSVGMPSKTEAVVACSLC
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggtggccagcggtggacgtcctgatggtcccccttctatcacccccgagagccctctc
attgtaggtggcagagagtggcagggtatggcaggttcttgctggaacatcacctacgtt
caagactcggtaggacctgccaccagcaccctgatgtttgtggctggtgtggtgggcaac
gggctagcactgggcatcctgggtgcccgacggaggtcacacccatcggcgtttgcagtg
ttggtcactgggctggcagtgacggatctgctgggcacgtgcttcttgagccccgcggtg
tttgtggcctatgctcgaaacagctctttgctgggcctggcccacggtgggacgatgctg
tgtgacactttcgccttcgctatgactttcttcggcctggcctccacgctcatcctcttc
gccatggctgtggagcggtgcctggctctcagtcatccctacctgtacgcccagctggac
gggccccgctgtgcccgcttggctttgcctgccatctacgctttctgttgtctcttctgc
tcactgcccctgctgggcctgggcgagcaccagcagtattgtcccgggagctggtgcttc
atccgcatgcgttccccccagcctggtggctgtgccttctccctggcctatgccagtctc
atggccctgctggtgacctccatcttcttctgcaacggctccgtcactctcagcctctgt
cacatgtaccgccaacagagacggcaccatggctcgtttgtgccgacctctcgggcacga
gaggatgaagtttaccacctgattctgctggccctcatgacaggcatcatggccgtatgc
tccctgcctctcacgatcagaggattcacgcaggccatcgccccagacagcagagagatg
ggggacctccacgccttccgttttaatgccttcaaccccatcctggacccctgggtcttc
atccttttccgaaaggctgtcttccaacgcctcaagttctggttgtgttgtctgtgtgcc
cgttctgtccatggggatctgcagacgcccctctcccggcccgtgtcggggagaagagac
acactggctcccgattctctccaggctaaggaagggaactgggtgcccctgtcaacctgg
ggtacggggcaggtggcaccattgactgctgtgcctctgtctggtggtgatggctgttct
gtgggaatgccatccaaaacagaggctgtggttgcctgctccctctgctga

DBGET integrated database retrieval system