KEGG   Rattus norvegicus (rat): 292684
Entry
292684            CDS       T01003                                 

Gene name
Rsph6a, Dmwd, Hn1-ps1, Rshl1
Definition
(RefSeq) radial spoke head 6 homolog A
  KO
K19756  radial spoke head protein 4/6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    292684 (Rsph6a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     292684 (Rsph6a)
SSDB
Motif
Pfam: Radial_spoke
Other DBs
NCBI-GeneID: 292684
NCBI-ProteinID: NP_001019919
RGD: 1306786
Ensembl: ENSRNOG00000061526
UniProt: Q4V8E8
Position
1q21
AA seq 650 aa
MGDPPPNPDPSQTRRASQNSERARSREYSQPLLSIPEDGVQRPQQRGSRISQGSQDLQAT
GLPQWPQRPSLPPDIQDEEGTDLDVTLGYPSGLPMEFSQQHYLDDSGMLQQFPEGQSLLE
QLESNYQDSASGVLDQFNLYSREDDTFSQATQHGPYMRDDPTLHLGPSDLGFMPFVGEVP
DPEPRELAVQNAKAYLLQTSVSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTTQWE
WFHPKLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGEQEMEEEVTDSPVPNIMETAFYFE
QAGVGLSSDESFRIFLALRQLVEQQPIHSCRFWGKILGLSRSYLVAEVEFREGEEEGEEE
EVEEMMEGGEVLETHGEEEGEEDEEKVVDAVPKPQWKPPPVIPKEESRSGANKYLYFVCN
EPGRPWTRLPHVTPAQIVCARKIKKFFTGFLDTPVISYPPFPGNEANYLRAQIARISAAT
HISPLGFYQFGEEEGDEEEEGGAGRDSFEENPDFEGIPVLELVDSMANWVHHTQHILPQG
RCTWVNPMQKTEEEEELGEEEEKADEGMEEVEQEVGPPLLTPLSEDAEIMHLSPWTTRLS
CSLSPQYSVAVVRSNLWPGAYAYATGSLRTCTLAGVTSIAPRTSIQCCQL
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgggggatccaccgcccaaccctgacccctcccaaacccggagggcttcccaaaactca
gaaagggcacggagtcgtgagtactcgcagcctctgttgtccatcccggaggatggggtg
cagcgaccgcagcagcggggcagtcggatcagtcagggcagtcaggacctgcaggcaact
ggcctgcctcagtggccacagaggcccagcctgcccccggatattcaggatgaggaaggc
accgacttagacgtgaccttaggctacccgtcaggccttcccatggagttctcacaacag
cattacctggatgatagcgggatgttgcagcagttcccggagggccagagcctcttagaa
caactggagtctaactaccaagactcggcctccggagtcctggaccaattcaacctctac
tcaagagaggatgacacattcagccaggccacacagcatggaccctacatgagagatgac
cccaccctccacttagggccctctgatctgggcttcatgccctttgttggagaggtgcct
gaccccgagcctcgtgagctggcagtacagaacgccaaggcctacctgctgcagaccagc
gtgagctgcaacctcagcctgtatgagcacctggtgaacctgctgaccaagatcctgaac
cagcggcccgaggaccccttgtccatcctggagtctctgaaccgcaccacgcagtgggaa
tggttccaccccaagctggacacgctgcgggacgaccccgagatgcagcccacctacgag
atggccgaaaagcaaaaggctctgtttatcaggggtggaggagaaggtgaacaggaaatg
gaagaggaggtgactgacagccccgtgcccaacatcatggagacagctttctacttcgag
caggcgggggtggggctgagctcggatgaaagcttccgaatcttcctggccctgaggcag
ctggtggagcagcagcccatccactcatgccgcttctggggcaagatcctgggcctgagc
cgcagctacctggtggccgaggtggagttccgcgagggcgaggaggagggagaggaggag
gaggtggaggagatgatggagggaggcgaggtcttggagacgcacggtgaggaggagggc
gaggaggatgaggagaaggtagtggacgccgtgcccaagccgcagtggaagccgccgcca
gtcatccccaaggaggagagccgcagcggcgccaacaaatacctgtacttcgtgtgcaac
gagccgggccgtccgtggacgcgcctgccgcacgtgacgcccgcgcagatcgtgtgcgcg
cgcaagatcaaaaagttcttcaccggcttcctggacactccggtcatcagctacccgccc
ttccccggcaacgaggccaactatctgcgcgcacaaattgcgcgcatctccgccgccacg
cacatcagcccgctgggcttctaccagttcggcgaggaggagggcgatgaagaggaggag
ggcggcgcggggcgcgactcgttcgaggagaaccctgactttgagggcatccccgtgttg
gagctcgtggactccatggccaactgggtacatcacacgcagcacatcctgcctcagggg
cgctgtacatgggtgaacccaatgcagaagacagaggaggaagaggagctgggggaggag
gaagagaaggcggacgaggggatggaggaggtagagcaggaggttggtcctccgcttctg
acccctctctcagaagacgcagaaatcatgcacctgtctccctggaccacccgcctctcc
tgcagcctcagccctcagtactcggtggccgtcgtgcgttccaacctctggccaggggcc
tatgcctacgccactggaagtttgagaacctgtacattggctggggtcacaagtatagcc
ccgagaacttcaatccaatgctgccagctctga

DBGET integrated database retrieval system