KEGG   Rattus norvegicus (rat): 29272
Entry
29272             CDS       T01003                                 

Gene name
Dpp6, DPP_VI
Definition
(RefSeq) dipeptidyl peptidase like 6
  KO
K23013  dipeptidyl aminopeptidase-like protein 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    29272 (Dpp6)
SSDB
Motif
Pfam: DPPIV_N Peptidase_S9 PD40 DLH DUF872 Abhydrolase_3
Other DBs
NCBI-GeneID: 29272
NCBI-ProteinID: NP_074041
RGD: 68402
Ensembl: ENSRNOG00000030547
UniProt: P46101
Position
4q11
AA seq 859 aa
MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDAGSKPLGPQAQAVAPRERGGAGGR
PRFQYQARSDCDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDTSLS
QKKKVTVEDLFSEDFKIHDPEAKWISDKEFIYRERKGSVILRNVETNNSTVLIEGKKIES
LRAIRYEISPDKEYALFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAG
WGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAHWW
SPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISLHVIGLNGPTH
DLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTKKHEDES
EAWLHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWD
VTEILTYDEKRNKLYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHN
MDFFLLKCEGPGVPTVTVHNTTDKRRMFDLEANEQVQKAIYDRQMPKIEYRKIEVEDYSL
PMQILKPATFTDTAHYPLLLVVDGTPGSQSVSERFEVTWETVLVSSHGAVVVKCDGRGSG
FQGTKLLHEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRVAVFGKDYGGYLSTYILPAKG
ENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKLAHRVSALEDQQFLI
IHATADEKIHFQHTAELITQLIKGKANYSLQIYPDESHYFHSVALKQHLYRSIIGFFVEC
FRIQDKLPTATAKEDEEED
NT seq 2580 nt   +upstreamnt  +downstreamnt
atggcttcgctgtaccaaaggttcaccggcaagatcaacacctcgcgctccttcccggcg
cccccggaggccagtcaccttctgggtggccaggggccggaggaggacgccggctcgaag
cccctcgggccgcaggcgcaggcggtggcacctcgggagcgcggcggtgctggtggccgg
ccccggttccagtaccaggcgcggagcgactgtgacgaggaggacgagctggtggggagt
aatcctccacagagaaactggaaaggaatcgccattgcactgcttgtcatccttgtcatc
tgctccctgattgtcacctcagtcatcctgctgaccccagcggaagataccagtctgtct
cagaagaagaaggtgactgtggaagatcttttcagtgaagacttcaaaatccatgaccca
gaggcaaagtggataagcgataaggaattcatctacagagaacggaaagggagcgtcata
ctgcggaacgttgagacaaataattccacggtgttaatagaaggcaaaaaaattgaatcg
ttaagagccatcagatatgaaatatccccagataaagagtatgcgttgttttcctataat
gtggaaccggtataccaacactcccacactggatattatgttctgagcaaaattcctcac
ggggaccctcagagtctggacccaccagaagtcagcaacgcgaagcttcagtatgcaggg
tggggcccgaaaggccagcagctgatatttatctttgagaacaacatctactactgtgcc
catgttggaaagcaggcgattcgagtggtctctacggggaaggagggtgtgatctacaat
ggcctcagcgactggctgtatgaagaggagattctgaagagccacatcgcacattggtgg
tcgccagatggtacaaggctcgcctatgccaccatcaatgattcccgagttccacttatg
gagctgccaacctacacgggctctgtctaccccactgtgaagccctaccactatcctaag
gctggcagtgaaaaccccagcatctccctccacgtcatcggcttgaatggacccacccac
gacctggagatgatgccacctgacgacccccgcatgagagagtattacatcaccatggtg
aagtgggccaccagcaccaaggttgctgtgacctggctgaaccgggcccagaatgtgtcc
atcctgaccctctgtgatgccaccacaggtgtctgcactaagaaacacgaggatgaaagt
gaagcttggctccacagacagaatgaagagcccgtgttctccaaggatggccggaagttt
ttctttgtcagagcgatcccacagggaggccggggtaaattctaccacatcactgtatcc
tcatcccagcccaacagcagcaatgacaacatccagtccattacctctggggactgggat
gtgaccgagatcctgacctacgatgagaagcggaataagctctatttcctaagcacagag
gacctgccacgaagacgacacctctacagcgccaacacggtagacgacttcaacaggcag
tgtctgtcatgtgacctggtggagaactgcacctatgtcagtgcttccttcagtcataac
atggacttcttcctgctcaagtgtgaaggccctggcgtacccactgttactgtgcacaat
accacggataagagaagaatgtttgacttggaagcaaatgagcaagtgcagaaagccatc
tacgatcggcagatgcctaaaattgaataccggaaaattgaagtggaagattacagcttg
ccaatgcaaatcttgaagccggccaccttcactgacacagcccactaccctttattgctc
gtggtggatggtactccagggagtcagagcgtgtcagagaggtttgaagtgacctgggag
acagtgttggtgagcagccatggagcagtggtggtcaagtgtgacggccgaggcagcggc
tttcagggaaccaagctcttgcacgaagtacggaggcggctaggcttcctggaggagaag
gaccagatggaagctgtgagaaccatgctgaaggagcagtacattgacaagactcgggta
gctgtgtttgggaaggattatggtgggtacctgagtacttacatcctcccagccaaggga
gaaaaccaaggccagactttcacctgcggctctgcactctctccgataacggacttcaaa
ctctatgcctcagcattttccgagaggtaccttggcctccatggactcgacaacagagcg
tatgagatgaccaagctggcacacagagtgtcagcactggaggaccagcagttcctgatc
atccatgctacggctgacgaaaaaatccatttccagcacacagcagagctcatcacgcag
ctaatcaagggaaaggccaattacagcttacagatatacccagatgaaagtcactacttt
cacagcgtggcgctcaaacagcacctgtacaggtccatcatcggattctttgtggaatgt
ttcaggatccaggacaagctacctacagccacagcgaaagaggacgaggaggaggactaa

DBGET integrated database retrieval system