KEGG   Rattus norvegicus (rat): 292737Help
Entry
292737            CDS       T01003                                 

Gene name
Blvrb
Definition
(RefSeq) biliverdin reductase B
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00740  Riboflavin metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    292737 (Blvrb)
   00860 Porphyrin and chlorophyll metabolism
    292737 (Blvrb)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     292737 (Blvrb)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     292737 (Blvrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD Semialdhyde_dh TrkA_N
Motif
Other DBs
NCBI-GeneID: 292737
NCBI-ProteinID: NP_001099706
RGD: 1306080
Ensembl: ENSRNOG00000024410
UniProt: B5DF65
Position
1q21
AA seq 206 aa AA seqDB search
MAVKKIAIFGATGRTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPQPAHVVVGDVLQAGD
VDKTVAGQDAVIVLLGTGNDLSPTTVMSEGTRNIVAAMKAHGVDKVVACTSAFLLWDPSK
VPPRLQDVTDDHIRMHKILEESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHD
LGHFMLRCLTTHEYDGQKTYPSHQYD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagaagatcgcgatcttcggtgccaccggaaggaccgggctcaccacactg
gcgcaggcggtgcaagcaggttacgaggtgacggtgctggttcgagattccagcaggtta
ccgtcagaggggccccagccagcccacgtggtggtgggagatgttctgcaggcgggcgat
gtggacaagactgtggctggacaggatgccgtcatcgtgctactgggcactggcaacgac
ctcagtcctactacagtaatgtccgagggcacccggaacattgtggcagccatgaaggca
catggagtggacaaggtcgtggcctgcacctcggccttcctactctgggacccgagcaag
gtgccccctcgcctacaggacgtgaccgatgaccacatccggatgcataagattctggag
gagtcaggactgaagtacgtggctgtaatgcccccacacattggggaccaaccactaacc
ggggcctacacagtgaccctggatggacgagggccctcgagggtcatatccaagcatgat
ctgggtcacttcatgctacggtgcctcaccacccatgagtatgacggacagaagacctac
ccttcccaccagtatgactag

DBGET integrated database retrieval system