KEGG   Rattus norvegicus (rat): 29274
Entry
29274             CDS       T01003                                 

Gene name
Rnf4
Definition
(RefSeq) ring finger protein 4
  KO
K22651  E3 ubiquitin-protein ligase RNF4 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    29274 (Rnf4)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     29274 (Rnf4)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    29274 (Rnf4)
SSDB
Motif
Pfam: zf-C3HC4_2 zf-RING_2 zf-RING_UBOX zf-C3HC4 zf-RING_5 zf-C3HC4_3 Prok-RING_4 zf-UDP zf-RING_4 zf-rbx1 zf-C3HC4_4 Rtf2 zf-RING_11 TerY_C Zn_ribbon_17 zinc-ribbons_6 zf-ANAPC11 DUF1272 zf-RING_10 zf-RING_6 FAM216B zf-P11 DZR zf-C3HC4_5
Other DBs
NCBI-GeneID: 29274
NCBI-ProteinID: NP_062055
RGD: 3583
Ensembl: ENSRNOG00000013930
UniProt: O88846
Structure
PDB: 
3NG2 5AIU 4AP4 5AIT

Position
14q21
AA seq 194 aa
MSTRNPQRKRRGGAVNSRQTQKRTRETTSTPEISLEAEPIELVETVGDEIVDLTCESLEP
VVVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSKDKDVYVTTHTPRST
KDEGTTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTC
RKKINHKRYHPIYI
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagtacaagaaatcctcaaagaaagcggcgtggtggagctgtgaattctagacaaacc
cagaagcgaactcgggaaacaacttcaacccctgagatttccttggaagcagaacccata
gaacttgtggaaaccgttggagatgaaatcgtggacctcacctgtgaatctttagagcct
gtggttgtggacctgactcacaatgactctgttgtgattgttgaagaaaggagaaggcca
aggagaaatgggaggaggttgcgccaagaccatgctgacagctgtgtggtgagcagtgat
gatgaagaactgtctaaggacaaagatgtatacgtgactacccatactcctcgaagcacc
aaggatgaaggaactactggacttaggccctcgggcaccgtcagttgtccgatctgcatg
gatggatactctgagattgtgcagaatgggcgtctcattgtttctacagaatgtggccac
gtcttctgtagccagtgcctccgtgattcccttaagaatgctaacacttgcccaacttgt
aggaaaaagatcaaccataaacggtaccatcccatttatatatga

DBGET integrated database retrieval system