KEGG   Rattus norvegicus (rat): 292755Help
Entry
292755            CDS       T01003                                 

Gene name
Nccrp1, RGD1305932
Definition
(RefSeq) non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FBA
Motif
Other DBs
NCBI-GeneID: 292755
NCBI-ProteinID: NP_001127978
RGD: 1305932
Ensembl: ENSRNOG00000054506
UniProt: D3ZQ18
Position
1q21
AA seq 291 aa AA seqDB search
MACPAPPPPVNLDPRNHDPVVQTLGMEKIPDRDALSGRMEAEGSQNSEELPPHPQSPPPP
PSPRSPTSPETPELPQPNAPTEFEARQLLVEEWGPVSGKLELPPSISWKLLFLERPLYRN
LLNSPNPEGINIYQPAPPTGPTRKPLKELGNFRGWYITTENLQGPLSWTVKEQCVNLLAK
KLWEELLDDEQPDITIMDWFEDSRLDQCVYELHVWLLAADRRTVIAQHHVAPRTNGRGPP
GRWVQVSHVFRQYGPGVRFVHFQHKTKNRMEPGGLRRTRVTDSSVSVQLRE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccccgcccctccacccccagttaacctggatcctaggaaccacgacccagtc
gtccaaaccttagggatggagaagataccggacagagacgcgctcagtggcaggatggaa
gccgaggggtcccagaactccgaggagctgccaccgcatcctcagtccccaccaccacct
ccgtccccaaggtctcccacgtccccggagacccctgagcttcctcagcccaatgcaccg
actgagtttgaagccaggcagctgctggtagaagaatggggacccgtgagcgggaagctg
gagctgcccccgagcatcagctggaagctgctgttcctggagcggccactctaccgcaac
ctcctcaactcacccaacccggaaggcattaacatctaccagccggcgccccctacgggt
cccacccggaaacctctgaaggagctgggtaatttccgtggatggtacattactactgag
aacctccagggacccctcagctggacagtgaaggagcaatgtgtgaacctgctggccaag
aagctgtgggaggagctgctggatgacgaacagcctgacatcaccatcatggactggttc
gaggacagccgcctagaccagtgtgtttatgagctgcatgtctggctgctagcagctgac
cgccgcaccgtcattgcccagcaccacgtggcccctcggaccaatgggagaggaccccct
ggccgctgggttcaggtgtcccacgtcttccgccagtacggccccggagtgcgttttgtc
cacttccagcacaagacgaagaaccgcatggagcctgggggactgcggaggacaagggtg
accgactcctccgtgtctgtgcagctccgggagtga

DBGET integrated database retrieval system