KEGG   Rattus norvegicus (rat): 292756
Entry
292756            CDS       T01003                                 

Gene name
Pak4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    292756 (Pak4)
   04014 Ras signaling pathway
    292756 (Pak4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    292756 (Pak4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    292756 (Pak4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    292756 (Pak4)
  09158 Development and regeneration
   04360 Axon guidance
    292756 (Pak4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    292756 (Pak4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    292756 (Pak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    292756 (Pak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    292756 (Pak4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     292756 (Pak4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   292756 (Pak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal KIND Kdo hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 292756
NCBI-ProteinID: NP_001099708
RGD: 1307705
Ensembl: ENSRNOG00000019883
UniProt: B5DF62
Position
1
AA seq 593 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEE
RAALARMAPDKAGGRGRATGHSEAGSGSGDRRRVGPEKRPKSSREGPGGPQEVSRDKRPL
SGPDVSTPQPGSLASETKLAAGRPFNTYPRADTDHPPRGTQGEPHTMAPNGPSAIGLAAP
QSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAPAVPPAPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRNR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgggtggagatctcggccccatccaacttcgagcaccgc
gtacacacaggcttcgatcagcatgagcagaagttcacagggctgccccgccagtggcag
agcctgattgaggagtcagcgcgcagacccaagcccctgatcgaccctgcttgcatcact
tccatccagcctggagcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gctctcacactgctgcttgacgaatttgagaacatgtcggtgacacgctccaactccctg
cgcagagagagtcctccaccccctgcccgcgcccatcaggaaaatggaatgctggaggag
cgggcagctctggccagaatggcccctgacaaagctggaggcaggggccgggccacaggc
cacagtgaggcaggcagtggcagtggtgacagacggcgggtggggccagagaagaggccc
aagtcatcaagggagggcccaggagggccccaggaggtctcccgtgataagcgccccctc
tctggtcctgatgtcagcactcctcagcctggcagtctggccagcgagacaaaactagca
gctggcagaccctttaacacataccctcgggctgacacggaccacccaccccggggtacc
cagggggagccacacaccatggcccctaatgggccatcagccataggcctggctgctcct
cagtcttcctcctcctcccggcctcccacccgagcccgtggtgctcccagcccgggagtg
ctgggtccccatgcctctgagccccagttggcccccccagcacgtgcccttgctgcccct
gctgtaccccctgctcctgggccccctgggcctcggtcaccacagcgggagccccaacga
gtatcccatgagcagttccgggccgccctgcagctagtggtggacccaggggaccctcgt
tcctatctagacaacttcatcaagattggcgagggctctacaggtattgtgtgcatagcc
actgtgcgaagctcgggcaaactggtggccgtcaagaagatggacttgcgtaagcagcag
agacgtgagctgctcttcaatgaggtggtgatcatgagggactaccggcatgaaaacgtg
gtggagatgtacaacagctacctggtaggcgatgagctctgggtggtcatggagttcctg
gagggaggcgccctcacggatattgtcacccacaccaggatgaatgaggaacagattgcc
gccgtgtgcctggctgtgcttcaggcgctgtctgtgctccatgcccagggcgtcatccac
cgtgacatcaagagtgactccatcctgctgacccacgatggccgggtgaagctgtccgac
ttcgggttttgtgcccaggtgagcaaggaggtgcctcggaggaagtcgctggtgggcacc
ccatactggatggccccagagctcatctcccgccttccctacgggccagaggtggatatc
tggtcactgggggtaatggtgatcgagatggtggatggggaacccccctacttcaacgag
ccacccctgaaagccatgaagatgattcgggacaacctgccgccccgactgaagaacctg
cacaaggcctcaccatctctgaaaggcttcttggatcgcctgctggtgcgtgacccagcc
cagcgggccactgctgctgagctgctgaagcacccgttcctcaccaaggcggggccgcca
gccagcattgtgccccttatgcgccagcaccgaaacagatga

KEGG   Rattus norvegicus (rat): 29431
Entry
29431             CDS       T01003                                 

Gene name
Pak1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04360  Axon guidance
rno04392  Hippo signaling pathway - multiple species
rno04510  Focal adhesion
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
rno05170  Human immunodeficiency virus 1 infection
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29431 (Pak1)
   04012 ErbB signaling pathway
    29431 (Pak1)
   04014 Ras signaling pathway
    29431 (Pak1)
   04392 Hippo signaling pathway - multiple species
    29431 (Pak1)
   04024 cAMP signaling pathway
    29431 (Pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29431 (Pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29431 (Pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    29431 (Pak1)
   04650 Natural killer cell mediated cytotoxicity
    29431 (Pak1)
   04660 T cell receptor signaling pathway
    29431 (Pak1)
   04666 Fc gamma R-mediated phagocytosis
    29431 (Pak1)
   04062 Chemokine signaling pathway
    29431 (Pak1)
  09158 Development and regeneration
   04360 Axon guidance
    29431 (Pak1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29431 (Pak1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29431 (Pak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29431 (Pak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29431 (Pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29431 (Pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29431 (Pak1)
   03036 Chromosome and associated proteins [BR:rno03036]
    29431 (Pak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29431 (Pak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   29431 (Pak1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    29431 (Pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    29431 (Pak1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     29431 (Pak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal DSHCT APH Kdo
Other DBs
NCBI-GeneID: 29431
NCBI-ProteinID: NP_058894
RGD: 3250
Ensembl: ENSRNOG00000029784
UniProt: P35465
Structure
PDB: 
1E0A

Position
1
AA seq 544 aa
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILA
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcttagacgtccaggacaaacccccagcccctccgatgagaaacacc
agcactatgattggagctggcagcaaagaccctggaaccctaaaccacggttccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccggttctatcgatccatcttagct
ggagataaaacaaataaaaagaaggagaaggagcggccagagatttctcttccttcagat
tttgagcatacaattcatgttggttttgatgctgtcacaggggagtttacggggatgcca
gaacagtgggcccgcttgcttcaaacatcaaatatcaccaagtcagagcagaagaaaaac
ccacaggctgttctggatgtgttggaattttataactccaagaagacctccaatagtcag
aagtacatgagttttacagataagtcagctgaagattataattcttctaatactttgaat
gtgaagactgtgtctgagaccccagcagtgccaccagtgtcagaagatgaagatgatgat
gacgatgctaccccacctccagtgattgctccacgcccagaacacacaaaatctgtatat
acacggtctgtgattgaaccacttcctgttactccaactcgggatgtggctacatctcct
atttctcctactgagaataacaccactccgccagatgctttgacccggaatactgaaaag
cagaagaagaagcctaaaatgtctgatgaggagatcttagagaaattacggagcatagtg
agtgtgggcgatcctaagaagaagtacacacgcttcgagaagattggacaaggtgcttca
ggcacagtgtacactgcaatggatgtagccacagggcaggaggtggccattaaacagatg
aaccttcagcagcagccgaagaaagaactcattattaatgagatcctggtcatgagggaa
aacaaaaacccaaacattgtgaactatctggacagttaccttgtgggagatgagctatgg
gttgtcatggaatacttggccggaggctccttaacagatgtggtgacagaaacctgtatg
gatgaaggccagatagcagctgtgtgccgagagtgtctacaagctttggagttcctgcat
tcaaaccaagtcattcacagagacatcaagagtgacaatattctgctgggaatggatggc
tctgtcaaattaactgactttggattctgtgcacagataactccagagcagagcaaaagg
agcaccatggtgggaactccatattggatggcacctgaagttgtgacacgcaaggcctat
ggacccaaggttgacatctggtccctgggtattatggcaattgaaatgattgagggggag
cccccatacctcaatgaaaaccctttgagagccttgtacctcattgctaccaatgggacg
ccagagcttcagaacccagagaagttgtcagctattttccgggactttttgaaccgctgt
cttgagatggatgtggagaagagaggttcagctaaagagctactgcagcatcaattcctg
aagattgccaagcctctctccagcctgactccactgattgctgcagcaaaagaggcaacc
aagaacaatcactga

KEGG   Rattus norvegicus (rat): 29432
Entry
29432             CDS       T01003                                 

Gene name
Pak2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29432 (Pak2)
   04012 ErbB signaling pathway
    29432 (Pak2)
   04014 Ras signaling pathway
    29432 (Pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29432 (Pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29432 (Pak2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    29432 (Pak2)
  09158 Development and regeneration
   04360 Axon guidance
    29432 (Pak2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29432 (Pak2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29432 (Pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29432 (Pak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29432 (Pak2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   29432 (Pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal ABC1 APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 29432
NCBI-ProteinID: NP_445758
RGD: 61953
Ensembl: ENSRNOG00000048597
UniProt: Q64303
Position
11
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEYTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTREAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggggagctagaggacaagcccccagcacctccagtgcggatgagcagc
accatttttagcactggaggaaaggatcctttatcagccaatcacagtttgaagcctttg
ccttctgttccagaggaaaaaaaaccgaggaacaaaatcatctccatattctcaagcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctccgccgtctgatttt
gagtataccatccatgttggctttgatgctgttacgggagagttcactggcatgccagag
cagtgggcacggctgttgcagacctccaacattaccaaactggagcagaagaagaacccg
caggctgtgctggatgtcttgaagttctacgactccaacactgtgaagcagaagtacctg
agcttcactcctcctgagaaagatggctttccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtggtgacagaggaagacgatgacgatgaagatgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatctacacaaggtctgtcatcgac
cctattcctgctccagttggtgactctaatgtcgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatacacaagatatgaaaaaatcgggcaaggggcttct
ggtacagtttttactgcaactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaggag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagacgagttgttt
gtggtaatggagtaccttgctggtgggtccctcactgatgtcgtgacagaaacctgcatg
gatgaagcgcagatcgcagctgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaactcactgattttggcttctgtgcccagatcacccctgaacagagcaaacgc
agtacaatggttggaacgccatactggatggcaccggaggtagtcacgcgggaagcctat
ggccccaaagttgacatatggtctctgggcatcatggctatcgaaatggtggaaggagag
cctccatacctcaatgaaaatcctttacgggcattatacctgatagcaacgaatggaaca
cctgagctccagaatccagaaaaactttcccccatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaagaggggttcagccaaagaactattacagcatcctttcctg
aaactggccaaaccattatccagcttgacgcctctgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

KEGG   Rattus norvegicus (rat): 29433
Entry
29433             CDS       T01003                                 

Gene name
Pak3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
rno05170  Human immunodeficiency virus 1 infection
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    29433 (Pak3)
   04014 Ras signaling pathway
    29433 (Pak3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29433 (Pak3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29433 (Pak3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    29433 (Pak3)
  09158 Development and regeneration
   04360 Axon guidance
    29433 (Pak3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    29433 (Pak3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29433 (Pak3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29433 (Pak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29433 (Pak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29433 (Pak3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   29433 (Pak3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal ABC1 Kinase-like Spt5_N DSHCT APH Kdo
Other DBs
NCBI-GeneID: 29433
NCBI-ProteinID: NP_062083
RGD: 3251
Ensembl: ENSRNOG00000004676
UniProt: Q62829
Position
X
AA seq 544 aa
MSDSLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHQSNTKTASEPPLAPPVSEEEDEEEEE
EEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEATPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAIK
NSSR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctgacagcttggataacgaagaaaaacctccagctcccccactgaggatgaacagt
aacaaccgagattcttcagcactcaaccacagctccaaaccactgcccatggccccggaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagaacgcccagagatctctcttccttcagactttgagcatacgatt
catgtgggttttgatgcagtcaccggggaattcactggaattcctgaacaatgggctcga
ctgctccaaacctccaacattacaaaactggaacagaagaagaacccacaggctgttctg
gatgttctcaagttttacgactccaaagaaacagtcaacaaccagaaatacatgagcttt
acatcaggagataaaagtgcccatggatatatagcagcacatcagtcgaataccaaaaca
gcttcagaacctcctttggctcctcctgtatctgaagaagaggatgaagaagaggaagag
gaagaagatgataatgagcccccgcctgtcattgcaccaagaccagagcatacaaaatca
atctatactcgttctgtggttgagtcaattgcttcaccagcagcaccaaataaagaagcc
accccaccttctgctgagaatgccaattccagtactttgtacaggaatacagatcggcaa
agaaaaaaatccaagatgacagatgaggagatcctagagaagctaagaagcattgtgagt
gttggggacccaaagaagaaatatacaagatttgaaaaaattggccaaggggcatcagga
actgtttacacagcactagacattgcgacaggacaagaggtggctataaagcaaatgaac
cttcaacagcagcccaaaaaggaattaattattaatgaaattcttgtcatgagggaaaat
aagaaccccaatattgtcaattatttagatagctacttagtgggtgatgaactgtgggta
gtcatggaatacttggctggtggctctttgactgacgtggtcacagaaacctgtatggat
gaaggacagatagcagccgtctgtagagagtgcctccaagctttggatttcttgcactca
aaccaagtgatccacagagatataaagagtgacaatattctcctcgggatggatggttct
gttaaactgactgattttggattctgtgcccaaatcactcctgagcaaagtaaacgaagc
actatggtgggaactccctattggatggcacctgaggtggtaactcgaaaagcttatggc
ccgaaagttgatatctggtctctgggaatcatggccattgaaatggtggaaggtgaaccc
ccttaccttaatgaaaatccactcagggccttatatctgatagccactaatggaacccca
gagctccagaatcccgagagactgtcagctgtattccgtgacttcttaaatcgctgtctt
gagatggatgtggatagacgagggtctgccaaggagcttttgcagcatccatttttaaaa
ttagccaagcccctgtccagcctcactcctctgattcttgctgcaaaggaagccattaag
aacagtagccgttag

KEGG   Rattus norvegicus (rat): 296078
Entry
296078            CDS       T01003                                 

Gene name
Pak6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    296078 (Pak6)
   04014 Ras signaling pathway
    296078 (Pak6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296078 (Pak6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296078 (Pak6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    296078 (Pak6)
  09158 Development and regeneration
   04360 Axon guidance
    296078 (Pak6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    296078 (Pak6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    296078 (Pak6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    296078 (Pak6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     296078 (Pak6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   296078 (Pak6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like ABC1 Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 296078
NCBI-ProteinID: NP_001099968
RGD: 1306213
Ensembl: ENSRNOG00000007925
UniProt: D3ZQ51
Position
3
AA seq 681 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSSVPTEGYISGLLNDIQKLSAISSNTLRGRSPTSRRRAQSLGLLGDD
QWAADPDMYLQSPQSERTDPHGVYLSCNGGTPAGHRQTPWPEPQSPQALPNGMAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGTSPPMATGRRGVKVTKHSSEEARPQSCLVGSAIGR
PGGEGSPSPKTQESSLKHRLFRSMFLSTPATGSASSSKPVPLPQNKLNSAFRPPQKDSSS
NLVAKAQSLPSDQPTGTFSPLTTSDTSSPQKSLRTAPATGPLPGRSSPAGSPRTRHAQIS
TSNLYLPQDPTVAKGALGGEDTGIVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEMYKSYLVGEELWVL
MEFLQGGALTDIISQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSYKVSPVLRDFLERMLVREPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccgaaagaagaagaagaaacgccctgagatatcagccccacagaacttccagcac
cgtgttcacacctcatttgaccccaaggaaggcaagttcgtgggcctgcccccacaatgg
cagaacatcctggatactctgaggcggcccaagcctgtggtggatccttctcgaatcaca
cgggtgcagttgcagcccatgaagacggtagtacggggcagctcagtgcccacagagggc
tacatctccgggctgctcaatgacattcagaagttgtcagctatcagctccaacactctg
cgtggacgcagccccaccagccggcggcgggcacagtccctggggctgctaggagatgat
cagtgggcggctgacccggatatgtacctccaaagtcctcagtctgagcgcactgatccc
catggcgtctacctcagctgtaatgggggcacaccagcaggtcacaggcaaacgccatgg
ccagaaccacagagcccacaggccctgcccaatggcatggctgccaaggcacagtcgctg
ggccccgctgagttccagggtgcctcccaacgctgcctgcagctgggtgcctgcctacag
agttccccacctggtacctcaccccctatggccacagggaggcgtggggtgaaggttacc
aagcatagctcggaagaggctcgaccacaatcttgcctggtgggctcagccattggcaga
ccaggtggagaaggcagccccagccctaagacccaggaaagcagcctcaagcaccggctc
ttccgcagcatgttcctgtccactcccgccacaggctctgcaagcagcagcaagccggtc
cctctgccacagaacaagctcaattctgctttccgaccaccacaaaaagattcctcttca
aacctggtagccaaggcccagtccttgccctcagatcagcccacggggaccttcagtcct
ctgaccacctcagataccagcagtccccagaagtccctccgcacagccccagccactggt
ccacttccaggccggtcttctccagcaggctccccccgcacccggcatgcccagatcagc
accagcaatctatacctgccccaggaccccacagtggccaagggggccctgggtggcgaa
gacacaggcatcgtaacacatgagcagttcaaagctgcgctcaggatggtggtggaccag
ggtgaccctcggctgctgctggacagctatgtgaagattggggagggctccacgggcatt
gtgtgtctggcccgggagaagcattcaggtcgccaggtagcagtcaagatgatggacctc
agaaagcagcaacgcagggaactgctctttaatgaggtggtgatcatgcgtgactaccag
cacctcaatgtggtggagatgtacaagagttacctggtaggagaggagctgtgggtgctg
atggagttcctgcagggcggggccctcacagacatcatctcccaagtcagactcaatgag
gaacagattgctactgtgtgtgaagctgtgcttcaggccttggcttacctgcacgcccag
ggtgtcatccaccgagacatcaagagtgattccatcctgctgacccttgatggcagggtg
aagctctcagactttgggttctgtgctcagatcagcaaagatgtccccaagagaaagtct
ctcgtaggaactccatactggatggctcctgaggtgatctccagatccctgtacgctact
gaggtggatatctggtctctgggcatcatggtgattgagatggtggatggagaaccccct
tacttcagcgactccccagtgcaagccatgaagaggctccgggacagccccccacccaag
ctaaagaactcttacaaggtctctccagtgctgcgagacttcctggaacgaatgctggta
cgggaaccccaagagagagccacagcccaggagctcctggatcacccctttctgctgcag
acggggctgcccgagtgtctggtgcctctgatacagctctaccgcaagcagacctccacc
tgctga

KEGG   Rattus norvegicus (rat): 311450
Entry
311450            CDS       T01003                                 

Gene name
Pak5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    311450 (Pak5)
   04014 Ras signaling pathway
    311450 (Pak5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    311450 (Pak5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    311450 (Pak5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    311450 (Pak5)
  09158 Development and regeneration
   04360 Axon guidance
    311450 (Pak5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    311450 (Pak5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    311450 (Pak5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    311450 (Pak5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     311450 (Pak5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   311450 (Pak5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 311450
NCBI-ProteinID: NP_001101251
RGD: 1312009
Ensembl: ENSRNOG00000005509
UniProt: D4A280
Position
3
AA seq 718 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKESSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRIQGHS
EENGFITFSQYSSESDTTTDYTTEKYRDRSLYGDDLDLYYRGSHAAKQNGHAMKMKHGDA
YYPEMKPLKSDLARFPVDYHTHLDSLSKASEYGDLKWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSFDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKVGYSSSSHQYPGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSSD
QQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMN
EEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRK
SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPP
RVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagatcgaaatatccggcccatctaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggcccaagcctatggtggatccatcatgcatcaca
cccatacaactggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaagc
tctatcaacggtctgctagaggatttcgacaacatctccgtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcattcaaggccactcc
gaagaaaacggcttcattactttctcacaatattctagtgaatctgatactactacggac
tacacaactgaaaagtatagagacaggagtctctatggagacgacctggatctgtactat
agaggcagccatgcagccaagcaaaacgggcatgctatgaagatgaaacatggagatgcc
tactatcctgagatgaagcctttgaaatccgacctggccagattccctgtcgactatcac
acacacttggactcgctgagcaaagcaagtgagtacggtgacctcaagtgggattatcag
cgagcctccagtagctcccctctggactactcattccagctcacgccttccagaactgca
gggaccagcaggtgctccaaggagagtctggcatacagtgaaagtgattggggacccagc
tttgatgactatgataggaggccaaaatcatcctacctgcatcagacaagccctcagcca
gccatgcgccagagatccaagtcaggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcatcctcaaggacactcgtacaactcctacacctaccctcga
ttgtctgagcccacaatgtgcattccaaaggtggattatgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacctatcccagaggccccaccaaactacctcaaagt
caaagcaaagtgggctactcttcaagtagccaccagtatcctgggtaccacaaagcatcc
ctataccatcatccgtccctgcaaaccagttctcagtacatctccaccgcttcttacttg
agctctctcagtatctcctcgagcacctaccctccacccagctggggctcctcttcagac
cagcagccctctagggtatcccatgaacagtttcgagctgccctgcaactggtggtcagc
ccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgacaggc
atcgtgtgcattgcaacagagaagcacacaggcaagcaagtggcggtgaagaaaatggac
ctccgaaagcaacagagacgggaactcctttttaatgaggtcgtgataatgcgtgattac
caccatgacaatgtagttgacatgtataacagctaccttgttggagatgagctctgggtg
gtcatggagtttctagaaggtggtgccttgacagacatcgtcactcataccagaatgaat
gaagaacagatagctactgtctgcctgtcagttctgaaagcgctgtcctaccttcataac
caaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggccgg
ataaagttatctgactttggcttctgtgctcaagtttccaaagaggtgccaaagaggaag
tcactggtgggtaccccatactggatggctcctgaggtgatttccaggctaccttatggg
acagaggtggacatctggtccctcgggataatggtgatagagatgattgatggtgagcct
ccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacctcca
agagtgaaggacctgcacaaggtttcttccatgctccgaggattcctagatcttatgttg
gtgagggagccctctcaaagagccacagctcaagaacttcttggacatccattcttaaaa
ttggcaggcccgccatcttgcatcgttcccctcatgagacaatataggcatcactga

DBGET integrated database retrieval system