KEGG   Rattus norvegicus (rat): 292757Help
Entry
292757            CDS       T01003                                 

Gene name
Fbxo17, Fbg4, Fbx17, Fbxo26
Definition
(RefSeq) F-box protein 17
  KO
K10101  F-box protein 17
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    292757 (Fbxo17)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    292757 (Fbxo17)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     292757 (Fbxo17)
Lectins [BR:rno04091]
 F-box lectins
  292757 (Fbxo17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA F-box-like F-box Sld3_N
Motif
Other DBs
NCBI-GeneID: 292757
NCBI-ProteinID: NP_001013082
RGD: 1308308
Ensembl: ENSRNOG00000019942
UniProt: Q6AY27
Position
1q21
AA seq 278 aa AA seqDB search
MGAQPSRRRMTEAQHMALAELPPELLLQVLSHVPPRALVTRCRPVCRAWRDLVDGPSVWL
LQLARDRSAEGRALYALAQSCPADRNGHDDFPLCALARFCLLAPLGRNLIYNSCGEQGFR
GWEVEHGGNGWAVEKNLTMVPGAPSQTCFVTSFEWCFKRQLVDLVKEGVWQELLDSAQIE
IYIADWWGARENCGCIYRLRVRLLDEHENEVVKFSASPNPVLQWTERSCRQVSHVFTDFG
KGIRYVSFEQYGRDTRSWVGHYGALVTHSTVRVRIRLS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccagccctcgcgacggcggatgaccgaagctcagcacatggctttggccgag
ctgcccccggagttgctgctgcaggtgctgagccatgtgcctcctcgcgcgttagtgacc
cgctgccggccggtgtgccgcgcctggcgcgacctagtagatggcccaagcgtatggctg
ctgcaactggctcgcgaccgcagcgcggagggcagagccctctacgccttggcccagagc
tgcccggccgaccgcaacggccacgacgacttcccactctgtgctctggcccgcttctgc
ctgctagcgccgcttggccgcaacctcatctacaactcctgcggagaacagggcttcaga
ggttgggaagtggaacatggcgggaacggctgggctgtggaaaagaatctgacgatggtg
ccaggggctccttctcaaacctgcttcgtgacttcttttgagtggtgcttcaagaggcag
cttgtagacctggtgaaggaaggagtgtggcaggagctgctggacagtgcccagattgag
atctacatagctgactggtggggcgcccgtgagaactgcggctgcatctacaggcttcgg
gtccgcctactggacgaacatgaaaacgaagtggtcaagttctctgcctcacccaaccca
gtccttcagtggactgagaggagctgccgacaagtctctcacgtcttcactgactttggc
aagggcatccgctatgtgtcctttgagcagtatggaagagacactcgttcctgggtggga
cactatggtgccctcgtgacccactccactgtgcgggtcaggatccgtctgtcctag

DBGET integrated database retrieval system