KEGG   Rattus norvegicus (rat): 292764
Entry
292764            CDS       T01003                                 

Gene name
Fam98c, RGD1303117
Definition
(RefSeq) family with sequence similarity 98, member C
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF2465
Other DBs
NCBI-GeneID: 292764
NCBI-ProteinID: NP_001185513
RGD: 1303117
Ensembl: ENSRNOG00000024036
UniProt: Q6AYE6 F1LQ27
Position
1q21
AA seq 344 aa
MDGAAVASDLLTLGYDALPEGASRGPACADFRALCARLAAELTTLGAVERREEGTAVLGA
GHGPDAEEEFLRQLAGLLRALHCPDRALCGGDCATMLREPGGGLRLLRFLCSELQAARLL
HLKLQRDPSPVPSFGEGTKEGNDVVQELMLTLKALGLPRPLRGTLASQLLREFHDKISEL
LPALPPESMKPLLNSPLDASRWEALEALSQSLTEQYGCRRCLLLKRLDLTTSAFHWGDRA
EAHSEVMKAVLCPIRGLLTPESDVSTAHVLAARADLSRLVPATSVAARRGTSCAINKVLM
GDVPDRGGRPSELEAPMPTWKSRREDGGRGKAGQQRWGRRKKKK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggatggggccgcggtagccagtgacctgctgacactggggtacgatgccctcccagag
ggggcgtctcggggccccgcgtgtgcggacttcagggcgctgtgcgcgcgactggcggcg
gagctgacgactctgggagctgtggagcggcgagaggagggcaccgcggttctcggcgcc
ggccacggcccggacgcagaggaagagttcctgcggcagttggctggcctgctgcgggcg
ttgcactgcccggatcgcgcgctctgcggcggagactgcgccaccatgctgcgggagccc
ggtggcggcctgcgcctgctgcggtttctttgctctgagctccaggctgctcgcctcttg
catctaaagctccagcgtgatcctagccctgtgccgtcctttggagaaggcacgaaggag
ggaaatgacgtggttcaggaactgatgctaactcttaaagccctggggctacctagaccc
ctgcgtggaaccctggctagccagctacttcgggagtttcatgacaagatctctgagctg
ctgcctgccctgcccccagagtccatgaagccccttcttaactcgccactggatgcatct
cgatgggaagccctggaggctttgtcccaaagcctgactgaacagtacggctgccgtcgc
tgcctcctcctgaagcgcctggacctcacaacatctgctttccactggggcgatcgggca
gaggcccacagtgaggtcatgaaggcagtgctctgcccaatccgagggcttctgactcca
gagtctgatgtctctaccgcacatgttctggctgcccgagctgacctttctcgcctggtc
ccagctaccagtgtggctgcccgacgagggaccagctgtgcaatcaacaaggtgcttatg
ggtgatgtgccagaccgtggggggcgcccaagcgagctggaggctcccatgcctacctgg
aagagccgaagagaggatggaggaagggggaaagctggccagcagcgctggggccgcaga
aagaagaagaagtaa

DBGET integrated database retrieval system