KEGG   Rattus norvegicus (rat): 292771Help
Entry
292771            CDS       T01003                                 

Gene name
Sipa1l3
Definition
(RefSeq) signal-induced proliferation-associated 1 like 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SPAR_C HAUS-augmin3 TMF_TATA_bd CENP-K
Motif
Other DBs
NCBI-GeneID: 292771
NCBI-ProteinID: NP_001013084
RGD: 1311432
Ensembl: ENSRNOG00000020703
UniProt: Q5BJW2
Position
1q21
AA seq 584 aa AA seqDB search
MSSGDSSSGGLTSQESTMERPKPEPLWHVPAQARLSAMTGSMGSKHPSRQDAAGKDSPNR
HSKGEPQYSSHSSSNTLSSNASSSHSDDRWFDPLDPLEPEPDPFSKGGSSDSGIDTTLYT
SSPSCMSLAKTPRPTKPHKPPGSIGLCGGGRESAGRPHPADRRREVSPAPAVAAQNKGYR
PKMYSSGSSTPPGLVGGSRDPPRQASDMGSRTGYPTQVYKTTSAETPRPSQLSQCSPFQL
STSVPKSFFSKQPAHNKHSTGWKRADEPPPRPLPFTESKKQVDTNAKNVFGQPRLRASLR
DLRSPRKNYKSTIEDDLKKLIIMDNLGPEQDRDTGPPQKSLQRTLSDESLCSGRREPSYA
SPTSLEPGLPSDVLFTSTCTFPSSTLPARRQHQHSHPPSGAPNTIPATGNGFPEKKSAIS
ASELSLADGRDRPLRRLDPGMMPLPDTAAGLEWSSLVNAAKAYEVQRAVSLFSLNDPALS
PDIPPAHSPVHSHLSLERGPQTPRTTPTMSEESPLDLTGKVYQLEVMLKQLHTDLQKEKQ
DKVVLQSEVASLRQNNQRLQEESQAASEQLRKFAELFSREKKEL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcggtgattcctcttcaggtggcctgaccagccaggagagcaccatggagcgc
cccaaaccagagcctctgtggcacgtgccagcccaggcccggctctccgccatgactgga
agcatgggcagcaagcatccctccaggcaggacgcggctggcaaagactctcccaacagg
cattccaaaggtgaacctcagtactcaagccattccagcagcaataccctctccagcaac
gcctccagcagccatagtgatgaccgatggttcgaccccctggaccccctggagccagag
ccagaccccttttccaagggaggctcgagtgacagtggcatcgataccacgctctacacc
tccagccccagttgtatgtccctagccaaaacaccgaggcccaccaagccacacaagccc
cccggaagtataggtctctgtggcggtggccgagagtcggccgggagaccccaccctgca
gacagacggcgggaagtctcccctgctccagcggtggccgctcagaacaagggctaccga
ccgaagatgtactcctcgggctccagcactcctccaggcctggtggggggcagccgagac
ccacccaggcaagccagtgacatgggttccaggaccggctacccgactcaggtttacaaa
acaaccagtgcagagactccccggccctcccagctctcccagtgcagccccttccagctc
tccacctcggtccccaagtctttcttctccaagcagcctgcacacaacaagcactcaacg
ggatggaagagagcagacgagcccccaccacggccactccccttcaccgaaagcaagaag
caggtggacaccaatgcaaaaaacgtctttggtcagccacggttgagggcatccctgcga
gacctccggtccccacggaagaattacaagtccaccatcgaggatgacttaaagaagctc
atcatcatggacaacctggggccagagcaggatcgggacacagggcccccccagaagagc
ctgcagcggacactgtcagatgagagcctgtgtagcggacgccgggagcccagctatgcc
agccctaccagcctggagcctggcctgcccagcgacgtgctcttcaccagcacctgcacc
ttcccttccagcacactgcccgcccgccgccagcaccagcactcccacccacccagcggg
gcacccaacaccattccagccactggcaatggcttcccagagaagaaatctgccatctca
gcctcggagctctcactggctgatggacgggaccggcccctgcgacgacttgaccctggg
atgatgccactacccgacacggctgctggccttgagtggtccagcctagtgaatgcggcc
aaggcctacgaagtgcaaagagctgtgtccctcttctctctgaacgacccagccctgagt
ccagatatccctcctgcacacagccctgtgcacagccatctgagcctggagcgaggcccc
cagactcctagaaccactcccaccatgagtgaggagtcaccgctggatctgacgggcaag
gtgtaccagctggaggtgatgctgaaacagctgcacacggacctgcagaaggagaagcag
gataaggtggtgctgcagtcagaggtggccagcctgcggcagaacaaccagcgactgcag
gaggagtcacaggctgccagtgaacagcttcgcaagttcgcagagctcttcagcagggag
aagaaggaactctga

DBGET integrated database retrieval system