KEGG   Rattus norvegicus (rat): 292778
Entry
292778            CDS       T01003                                 

Gene name
Polr2i
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB9
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    292778 (Polr2i)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    292778 (Polr2i)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    292778 (Polr2i)
   03400 DNA repair and recombination proteins [BR:rno03400]
    292778 (Polr2i)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     292778 (Polr2i)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      292778 (Polr2i)
SSDB
Motif
Pfam: RNA_POL_M_15KD TFIIS_C Zn_ribbon_recom DZR Ogr_Delta DUF3716 TF_Zn_Ribbon
Other DBs
NCBI-GeneID: 292778
NCBI-ProteinID: NP_001099714
RGD: 1309395
Ensembl: ENSRNOG00000020799
UniProt: D4A531
Position
1
AA seq 125 aa
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
NT seq 378 nt   +upstreamnt  +downstreamnt
atggaacctgacgggacgtacgagcctggcttcgtcggtattcggttctgccaggaatgt
aataacatgctgtaccccaaggaggacaaggagaatcgcattctgctgtacgcgtgccgg
aattgcgattaccagcaggaagccgacaacagctgcatctacgtcaacaaaatcacgcac
gaagtggacgagctgacccagatcatcgcagacgtgtcccaggaccctacgttgccccgg
accgaggaccacccgtgccagaagtgtggccacaaggaggcagtgttcttccagtcacac
agtgcccgagctgaggatgccatgcgcctgtactatgtatgcaccgccccacactgcggc
caccgctggactgagtga

DBGET integrated database retrieval system