KEGG   Rattus norvegicus (rat): 292787
Entry
292787            CDS       T01003                                 

Gene name
Lin37
Definition
(RefSeq) protein lin-37 homolog
  KO
K21774  protein lin-37
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    292787 (Lin37)
SSDB
Motif
Pfam: LIN37
Other DBs
NCBI-GeneID: 292787
NCBI-ProteinID: NP_001099715
RGD: 1308901
Ensembl: ENSRNOG00000020929
UniProt: D4A503
Position
1
AA seq 246 aa
MFPVKVKVEKSEMEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTLSDTHNKDCSIAA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPTVRERERSPGSPLPPLPEDGEGSEVINSKNRDVYKLPPPTAPAALGDACRSRI
PSPLQPETQGTTDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
EMYDRQ
NT seq 741 nt   +upstreamnt  +downstreamnt
atgttcccggtaaaggtgaaagtggagaaatcagagatggagatggccaaagcccggaac
cagctggatgccgttcttcagtgtctgctggagaagagtcacatggacagggaacgcctg
gatgaagaggctgggaaaaccctctcggatacacacaacaaggattgttccattgctgcc
acgggcaaaaggccatcggcccgcttccctcaccagcggaggaagaagagaagggagatg
gacgatgggcttgctgaggggggtcctcagagatccaatacgtatgtgatcaagctgttt
gaccggagtgtggacttggcccagttcagtgagaacacaccgttgtaccccatctgccgc
gcctggatgcgtaacagccctacagtgcgagagcgcgagcgctcacctggctcaccactg
ccccctctgccagaggatggagagggctcagaggtcatcaacagcaaaaatcgtgatgtg
tacaagctgcctccacccacggcccctgcagcacttggagatgcctgtagatcccgaatt
ccatccccactgcagcctgagacccagggtaccactgatgatgaaccctccgagcctgaa
ccttctccttccacacttatctatcgcaacatgcaacgctggaaacgcatacgccagagg
tggaaggaggcgtctcatcggaaccagcttcgttactcagaaagtatgaagatcctccgg
gagatgtatgatcggcagtga

KEGG   Rattus norvegicus (rat): 305171
Entry
305171            CDS       T01003                                 

Gene name
Lin54
Definition
(RefSeq) protein lin-54 homolog
  KO
K21776  protein lin-54
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    305171 (Lin54)
SSDB
Motif
Pfam: TCR MSL2-CXC
Other DBs
NCBI-GeneID: 305171
NCBI-ProteinID: NP_001094034
RGD: 1311361
Ensembl: ENSRNOG00000002203
UniProt: Q641Z1
Position
14
AA seq 749 aa
MEVVPAEVNSLLPDDIMDTAITLVDEDSIEAVIVSSPIPMETELEEIVSINSTGDSTATP
ISTEPITVYSNHTNQVAVNTTVSKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKV
SQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTAQAQPGDAKLPP
QQIKVVTIGGRPEVKPAIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGP
VITKLIFAKPINSKAVTGQTTQASPPVVTGRVLSQSAPGTPSKTITISESGVIGSTLNST
TQTPNKIAISPLKSPNKTVKSAVQTITVGGMSTSQFKTIIPLAAAPNVQPIQVPGSKFHY
VRLVTATTAGSSAPPVSQSPSVNTQPLQQAKPVVVNTTPVRMSVPFVQAQAVKQVVPKPI
NSTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQ
LQQSSYVSIAGNSNFTGTSGIQTQARVSFNGIIPSESASRPRKPCNCTKSLCLKLYCDCF
ANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCN
CKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKT
KLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER
MILEEFGRCLMSVINSAGKAKSDPCAMHC
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggaggtggtgccggccgaggtgaatagcttgcttccagacgacataatggacactgct
attactttagtggatgaggatagcattgaggctgtaattgtgtcatccccaattcccatg
gagacagaactggaagaaattgtcagcataaattctactggtgactctacagccacgccc
atttccacggaaccaatcacagtgtacagtaatcacactaaccaagttgcagtgaatacc
acagtttctaaagcagactccaataccacagtgaaaccagcatttccgagtggccttcaa
aagcttggtgctcagactcctgtgactatatcagccaatcagattattttaaacaaagta
tcacagacatctgatcttaaacttggcaatcagacccttaaaccagatggacagaagtta
atcttaacaactttgggcaagtctggctcaccaattgttttagcacttccccatagccaa
ctaccccaggctcagaaagttacagctcaggcccaaccaggagacgctaagttaccaccg
cagcagatcaaagtagttaccattggagggaggccagaggtgaaacctgccattggggtc
tcagcactgaccccaggaagtcaactgattaataccacaactcagccctctgtgttacag
acccaacagttaaaaacagtgcagattgctaagaagcctcgaacaccaacctcgggtcca
gtgatcacgaagctgatttttgcaaaaccaattaatagtaaagcagttacgggacagaca
actcaagcgtctccacccgtcgtcacaggcagggttctttcacagtctgctcctggaact
ccatccaagactataacaatatcagaaagtggtgttattggctcaactttaaattctaca
acacagacaccaaataagatagccatctcacctttgaagtcaccaaataagacagtgaag
tcggctgtgcagaccatcacggtgggcggaatgagcacgtcgcagtttaagaccatcatt
cccctggcagctgctcccaatgtccagcccattcaagtgcctggaagcaagtttcattat
gtccgactcgtcactgccacaaccgccggtagctcagccccaccagtcagtcagagtccc
agtgtcaacactcagcctcttcagcaagcaaagccagtggttgttaataccacgcctgta
cggatgtcagttccatttgtccaagctcaggccgttaagcaagttgttccaaaaccaatc
aattcaacttcacaaattgtaactactagccagccccagcaacggctcatcatgccggcc
acaccactgcctcagatccagcccaacctcactaacctgccgccaggcactgtgttggcg
ccagctccaggaacggggaacgtgggctacgcagtgcttccggctcagtacgtcactcag
ttgcagcagtcctcctacgtgtcgatagcaggcaactctaacttcaccgggacatcgggc
atccagacacaggcaagggtttcattcaacggcataattccatcagagtctgccagtcgg
cccagaaaaccctgtaactgtacaaaatcactgtgtttgaaattatactgtgactgcttt
gccaatggtgaattctgcaacaactgcaattgtaccaattgttacaacaacttagagcat
gagaatgagcgacaaaaggcaataaaggcatgccttgacagaaacccggaagccttcaag
ccaaagataggaaaaggaaaagagggggagtcggatcggcggcacagcaaaggctgtaac
tgcaaacggtcagggtgtcttaaaaactactgcgagtgctatgaggcaaaaatcatgtgc
tcctccatatgcaagtgcatcggctgtaagaacttcgaagaaagcccagaacggaagaca
ttgatgcacttagcagatgcggctgaagtaagggtccagcagcagacagcagcgaagacc
aagctgtcctctcagatctcagacctgcttaccaggcccacccccgctctgaacagtgga
ggaggaaaattgccattcacatttgtaactaaagaagtagctgaagccacgtgtaactgc
cttcttgcccaggcagagcaggcagacaagaaggggaaatcaaaggcggcagcagagcgg
atgatcctggaggagtttggacggtgtttgatgagcgtcatcaactctgcaggaaaagca
aaaagtgacccctgtgccatgcactgctaa

KEGG   Rattus norvegicus (rat): 310511
Entry
310511            CDS       T01003                                 

Gene name
RGD1563620
Definition
(RefSeq) histone-binding protein RBBP4
  KO
K10752  histone-binding protein RBBP4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    310511 (RGD1563620)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310511 (RGD1563620)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     310511 (RGD1563620)
  Histone modification proteins
   HAT complexes
    HATB complex
     310511 (RGD1563620)
   HDAC complexes
    Sin3A-HDAC complex
     310511 (RGD1563620)
   Polycomb group proteins
    PRC2-EZH1 complex
     310511 (RGD1563620)
    PRC2-EZH2 complex
     310511 (RGD1563620)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     310511 (RGD1563620)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    310511 (RGD1563620)
  Chromatin remodeling factors
   NuRD complex
    310511 (RGD1563620)
   NuRF complex
    310511 (RGD1563620)
   NuRF complex (fruit fly)
    310511 (RGD1563620)
SSDB
Motif
Pfam: WD40 CAF1C_H4-bd eIF2A ANAPC4_WD40 Capsid_NCLDV
Other DBs
NCBI-GeneID: 310511
NCBI-ProteinID: XP_038959637
RGD: 1563620
Position
2
AA seq 423 aa
MADKEVAFEDVVEERVINEEYKIWKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDF
GIHRLVLGTHTSDEQNHLVASVQLPNDDAQFDASYYDSEKGEFGGFGSVSGKIEIEIKIN
YEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNSDLHLRGHQKEGYG
LSWNPYLSGYLLSASDDHTICLWDISAVPKEGKVVGAKTIFTGHTAVVEDVSWHLLHESL
FGSVADDQKLMIWDTRSNNTSKPSHSVDAYTAEVNCLSFNPNSEFILASGSPDKTVALWD
LRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDG
PPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEG
QGS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggctgacaaggaagtggcctttgaggacgtggtggaagaacgtgtgatcaacgaggag
tacaagatatggaagaacaccccatttctttatgatttggtgatgacccatgccctggag
tggcccagcctaactgcccagtggcttccagatgtgaccaggcctgaagggaaagatttc
ggcattcatcggcttgtcctgggaacacacacatcagatgaacaaaaccaccttgttgcc
agtgtccagctccctaatgacgatgcgcagtttgatgcatcctattatgacagtgaaaaa
ggagaatttggaggttttggttctgtcagtgggaaaattgaaatagaaatcaagataaac
tatgaaggagaagtaaacagggccaggtacatgcctcagaacccttgcatcattgcaacg
aagactccatccagtgatgttcttgtttttgactacacaaagcacccttctaaaccagac
ccttctggagaatgcaactcagacttgcatctccgtgggcatcagaaggaaggttatggg
ctttcttggaatccatatctcagcgggtacttacttagtgcttcagacgaccataccatc
tgcctgtgggacatcagtgcagttcccaaagaaggaaaagtggtgggtgcaaagaccatc
tttacagggcacacagcagtagtggaggacgtttcctggcatctgctccatgagtctctg
ttcgggtcagttgctgatgaccaaaaactcatgatttgggatactcgttcaaacaatact
tccaagccaagccactcggttgatgcttacacagctgaagtgaattgcttatctttcaat
cctaatagtgagttcattcttgcctcgggatcacctgacaagactgttgccttgtgggat
ctgagaaatctgaaactcaagttgcattcctttgaatcacataaggatgaaatattccaa
gttcaatggtcacctcacaatgagactatcttagcttccagtggcactgatcgtcggctg
aatgtctgggatctaagtaaaattggagaagaacagtccccagaagatgcagaggatggc
ccaccagagttgttgtttattcatggtggtcacactgctaagatatctgacttctcctgg
aatcccaatgaaccttgggtaatttgttctgtatcagaagacaatatcatgcaagtgtgg
cagatggcagagaacatttataatgatgaagaccctgaaggaagtgtggatccagaagga
caaggatcctag

KEGG   Rattus norvegicus (rat): 313048
Entry
313048            CDS       T01003                                 

Gene name
Rbbp4
Definition
(RefSeq) histone-binding protein RBBP4
  KO
K10752  histone-binding protein RBBP4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    313048 (Rbbp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    313048 (Rbbp4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     313048 (Rbbp4)
  Histone modification proteins
   HAT complexes
    HATB complex
     313048 (Rbbp4)
   HDAC complexes
    Sin3A-HDAC complex
     313048 (Rbbp4)
   Polycomb group proteins
    PRC2-EZH1 complex
     313048 (Rbbp4)
    PRC2-EZH2 complex
     313048 (Rbbp4)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     313048 (Rbbp4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    313048 (Rbbp4)
  Chromatin remodeling factors
   NuRD complex
    313048 (Rbbp4)
   NuRF complex
    313048 (Rbbp4)
   NuRF complex (fruit fly)
    313048 (Rbbp4)
SSDB
Motif
Pfam: CAF1C_H4-bd WD40 eIF2A ANAPC4_WD40 Capsid_NCLDV
Other DBs
NCBI-GeneID: 313048
NCBI-ProteinID: NP_001101382
RGD: 1593768
Ensembl: ENSRNOG00000021492
UniProt: B5DFB2
Position
5
AA seq 425 aa
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctgacaaggaagcggcctttgacgacgcggtggaagaacgtgtgatcaacgaggag
tacaagatatggaagaagaacaccccatttctttatgatttggtgatgacccatgccctg
gagtggcccagcctaactgcccagtggcttccagatgtgaccaggcctgaagggaaagat
ttcagcattcatcggcttgtcctgggaacacacacatcagatgaacaaaaccaccttgtg
atagccagtgtccagctccctaatgacgatgctcagtttgatgcatcccattatgacagt
gaaaaaggagaatttggaggttttggttctgtcagtgggaaaattgaaatagaaatcaag
atcaaccatgaaggagaagtaaacagggccaggtacatgcctcagaacccttgcatcatt
gcaacgaagactccatccagtgatgttcttgtttttgactacacaaagcacccttctaaa
ccagacccttctggagaatgcaacccagacttgcgtctccgtgggcatcagaaggaaggt
tatgggctttcttggaatccaaatctcagcgggcacttacttagtgcttcagatgaccat
accatctgcctgtgggacatcagtgcagttcccaaagaaggaaaagtggtggatgcaaag
accatctttacagggcatacagcagtagtggaggacgtttcctggcatctgctccatgag
tctctgttcgggtcagttgctgatgaccagaaactcatgatttgggatactcgttcaaac
aatacttccaagccaagccactcggttgatgctcacacagctgaagtgaattgcttatct
ttcaatccttatagtgagttcattcttgccacgggatcagctgacaagactgttgccttg
tgggatctgagaaatctgaaactcaagttgcattcctttgaatcacataaggatgaaata
ttccaagttcaatggtcacctcacaatgagactatcttagcttccagtggcactgatcgt
cggctgaatgtctgggatctaagtaaaattggagaagaacagtccccagaagatgcagag
gatggcccaccagagttgttgtttattcatggtggtcacactgccaagatatctgacttc
tcctggaatcccaatgaaccttgggtaatttgttctgtatcagaagacaatatcatgcaa
gtgtggcagatggcagagaacatttataatgatgaagaccctgaaggaagtgtggatcca
gaaggacaaggatcctag

KEGG   Rattus norvegicus (rat): 362763
Entry
362763            CDS       T01003                                 

Gene name
Lin52
Definition
(RefSeq) protein lin-52 homolog isoform X1
  KO
K21775  protein lin-52
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    362763 (Lin52)
SSDB
Motif
Pfam: LIN52
Other DBs
NCBI-GeneID: 362763
NCBI-ProteinID: XP_006240418
RGD: 1306798
Ensembl: ENSRNOG00000043441
Position
6
AA seq 157 aa
MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPTWMAE
IERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDECKDKPSEGSSRCFQLSVDSHQQ
STPAGAGSLLPLLDFELHAKRKIDAPDTWPLLRGAFF
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggctggaagatggcgtctcccacagacgggacagatttggaagcatcgttgctaagt
tttgagaaacttgaccgtgcctcgccagatctttggcccgaacagttaccaggtgttgct
gaatttgcagcttctttcaaaagtcccatcacaagctctccaccaacatggatggctgaa
atagaacgggatgacattgatatgttgaaagaactggggagtctcaccacagctaatctg
atggagaaggtacgaggcctacagaacctggcctaccagctggggctggatgagtgcaaa
gacaagccatctgaaggttcttccagatgcttccagctctcagtagatagccatcagcag
tccacaccggcaggcgctggctccctcctccctctgctggactttgagctgcacgccaag
agaaagatagatgctcctgatacgtggccgctgcttagaggtgctttcttttaa

KEGG   Rattus norvegicus (rat): 689523
Entry
689523            CDS       T01003                                 

Gene name
Lin9
Definition
(RefSeq) protein lin-9 homolog isoform X1
  KO
K21773  protein lin-9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    689523 (Lin9)
SSDB
Motif
Pfam: LIN9_C DIRP DUF2664 DUF4168
Other DBs
NCBI-GeneID: 689523
NCBI-ProteinID: XP_001067807
RGD: 1591104
Ensembl: ENSRNOG00000023304
UniProt: M0R885
Position
13
AA seq 558 aa
MHRGGQPLKKRRGSFKMAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKG
RNAGPAVEMPFRNSKRSRLFSDEDDRQINTKSPKRNQRVAMIPQKFTATMSTPDKKASQK
IGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWG
KIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGT
KVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAA
FGQKQRPSRFFMTPPRLHYTPPLQSPITDGDPLLGQSPWRSKISGSDTETLGGFPVEFLI
QVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVLELEQLNKDLNK
VLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRQANSASGQPCVENENLTDLI
SRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKNTIDASNISCFQNNVEIHVAHIQSG
LSQMGNLHAFAANNTNRD
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcaccggggcgggcagcctttgaaaaagcggcgcggctcgttcaagatggcggagctc
gaccagttgcctgacgagagctcttcagcgaaagcccttgtcagtttaaaagagggaagt
ttatctaacacatggaatgaaaagtacagttctttacagaaaactcctgtttggaaaggc
aggaatgcgggccctgctgtagaaatgcctttcagaaattcaaaaagaagtcgactcttt
tctgatgaagatgacagacaaataaatacaaagtcacctaaaagaaaccagagagtcgca
atgatccctcagaaatttacagcaacgatgtcaacaccagataagaaagcatcacagaag
attggttttcgattgcggaacctactcaagcttcccaaagcacataaatggtgcatctat
gagtggttctactcaaacatagacaagccactttttgaaggagataatgacttctgtgta
tgtctaaaggaatcctttcctaatttaaaaacaagaaaattaacaagagtagaatgggga
aaaatcaggagattgatgggaaaacctcggaggtgttcttctgcatttttcgaggaagag
agatcagccttaaaacagaagcggcagaaaatcaggctgttgcaacaaaggaaagttgca
gatgtttcacagttcaaagatctccccgatgaaattcctctacccctggttattggaacc
aaagttacagcacgattacgtggcattcacgatggtctgtttactggtcagatagatgct
gtggatactcttaatgctacttacagagtaactttcgataggacagggcttgggactcac
accattcctgactatgaagttcttagtaatgagcctcatgagacaatgccaatcgctgcc
tttggacagaaacagcggccttctcggttttttatgacccccccacggttacattacacc
cctcctctccaatcaccaattacagatggtgatcccttgctaggacagtcgccttggaga
agtaaaatttctggctctgacacggagacgttaggaggctttccagtagaattccttatc
caggtgactaagttatcaaaaatcctcatgattaaaaaggagcacatcaagaaattaagg
gaaatgaacacagaagcagaaaagctgaagtcatactccatgcccataggcattgaattt
cagcggcggtatgcaacgattgttctggagctggagcagctgaacaaggacctgaacaaa
gtgctacacaaggttcagcagtactgctacgagcttgcaccagaccagggactccagcct
gctgatcagccgacagacatgaggcggaggtgtgaggaggaagcccaggaaatcgtccgg
caagccaactctgcctcagggcagccctgtgttgaaaacgaaaatctgacggacttaatc
tccaggctcactgcgattttattacaaattaagtgtctggcagagggaggagacctgaat
tcctttgaattcaaatccctgacagattcattaaatgacataaagaacacaatagatgct
tctaatatcagttgttttcagaataatgtagaaatccacgttgcacatatccagagtggc
ctgagccagatggggaacctgcacgcctttgcagccaacaacactaacagggactga

DBGET integrated database retrieval system