KEGG   Rattus norvegicus (rat): 29279
Entry
29279             CDS       T01003                                 

Gene name
Meox2
Definition
(RefSeq) mesenchyme homeobox 2
  KO
K09322  homeobox protein MOX
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29279 (Meox2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    29279 (Meox2)
SSDB
Motif
Pfam: Homeodomain Macoilin
Other DBs
NCBI-GeneID: 29279
NCBI-ProteinID: NP_058845
RGD: 3079
Ensembl: ENSRNOG00000006588
UniProt: P39020
Position
6q21
AA seq 303 aa
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGPPELG
SSPPVLCSNSSSLGSSTPTGAACAPRDYGRQALSPAEVEKRSGSKRKSDSSDSQEGNYKS
EVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK
WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANDDSRDSDHSSEH
AHL
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaacaccccctctttggctgcctgcgcagcccccacgccacagcgcaaggcttgcac
cccttctcgcagtcttctctggccctccatggaagatctgaccacatgtcctaccccgaa
ctctccacatcttcctcgtcttgcataatcgcgggataccccaatgaggagggcatgttt
gccagccagcatcacagggggcaccaccaccaccaccaccaccaccatcaccaccaccag
cagcagcagcaccaggctctgcaaagcaactggcacctcccgcagatgtcctccccgcca
agcgcggcccggcacagcctttgcctgcagcctgattccggagggcccccggagctgggg
agcagccctccggtcctgtgctccaactcttctagcctgggctccagcaccccgaccgga
gccgcgtgcgcaccaagggattatggccgtcaagcgctgtcacccgcagaagtggagaag
agaagtggcagcaaaagaaaaagcgacagttcagattcccaggaaggaaattacaagtca
gaagtgaacagcaaacctaggaaggaaagaacagctttcaccaaagagcaaatcagagaa
cttgaggcagagttcgcccatcataactatctgaccagactgagaagatatgagatagcg
gtgaacctagacctcactgaaagacaggtgaaagtgtggttccagaacaggagaatgaag
tggaagcgggtcaaggggggacaacaaggagctgcagcccgagaaaaggaactggtgaat
gtgaaaaagggaacacttcttccatcagagctgtcaggaattggtgcagccaccctccag
cagacaggggactcactagcaaatgacgacagtcgcgatagtgaccacagctctgagcac
gcacacttatga

DBGET integrated database retrieval system