KEGG   Rattus norvegicus (rat): 292793
Entry
292793            CDS       T01003                                 

Gene name
Sbsn, RGD1562305
Definition
(RefSeq) suprabasin
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF1664 Lsr2
Other DBs
NCBI-GeneID: 292793
NCBI-ProteinID: NP_001037696
RGD: 1562305
Ensembl: ENSRNOG00000021015
UniProt: Q32PY8
Position
1q21
AA seq 164 aa
MHLVNLLSSCCLLALLGALPARAAHEDPIEKAIEGFSRGLSNAEKEVGKALEGINNGITQ
AGREVERIFDGLSNMGSQAGKTVEHGLDKVAHGINSGVEHAGKEADRLAHGVNHAAGQGP
HQGQSGYGGQHGGAAITTAVSGASVNKPFINFPALWRSIAAIMP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcatcttgtcaatctgctcagctcctgctgcctcttagcactcctgggggctctgcct
gcacgggcagcccatgaggatcccattgagaaggccatagaagggttcagccgtgggctg
agcaacgcagagaaagaggtgggcaaggcccttgaaggcatcaataatggaatcactcaa
gccggaagggaagtggaaagaatttttgatggacttagcaacatgggcagccaggccggc
aagaccgtggagcatggcttggataaggtagcccacggcatcaacagtggcgtcgaacac
gcaggaaaggaagcagacaggttggcccatggggtcaaccacgccgctggacaggggcct
catcaaggtcaaagcggttacggaggccagcacggaggggccgcaatcactacagcagta
tctggggcctcggtcaacaagccatttatcaacttcccagctctgtggaggagtatcgcc
gccatcatgccctaa

DBGET integrated database retrieval system