KEGG   Rattus norvegicus (rat): 292794Help
Entry
292794            CDS       T01003                                 

Gene name
Ffar2, Gpr43
Definition
(RefSeq) free fatty acid receptor 2
  KO
K04328  free fatty acid receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    292794 (Ffar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    292794 (Ffar2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    292794 (Ffar2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx TAS2R
Motif
Other DBs
NCBI-GeneID: 292794
NCBI-ProteinID: NP_001005877
RGD: 1359614
Ensembl: ENSRNOG00000021021
UniProt: Q76EI6
Position
1q21
AA seq 330 aa AA seqDB search
MTPDWHSSLILTAYILIFLTGLPANLLALRAFVSRVRQPQPAPVHILLLNLTLADLLLLL
LLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLS
RRPLYGVIAALVAWIMSFGHCTIVIIVQYLNSTEQVGTENQITCYENFTQAQLDVVLPVR
LELCLVLFFVPMTVTIFCYWRFVWIMLTQPHVGAQRRRRAVGLAVVTLLNFLVCFGPYNM
SHLVGFHLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVVRRAFGKGLLLLRNPGSSMLG
RGAEETVEGTKTDRGGSQTEGAQSSDFVTE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagactggcacagttccttgatcctcacggcctacatcctcatctttcttact
gggctccctgccaacctgctggccctgcgggccttcgtgagccgggttcgccagccccag
cctgcacccgtgcacatcctcctgcttaatctgaccctggcggacttgctgttgttgctg
ctgctgcccttccggatcgtggaagctgcatccaacttccgctggtacctaccaaagatc
gtgtgcgcgctcacgggcttcggcttctacagcagtatctactgcagcacgtggctgctg
gcgggcatcagcatagaacgctacctgggagtggctttcccggtgcagtacaagctatcc
cgccggccactgtacggagtgatcgctgctctggtggcctggatcatgtcctttggccat
tgcaccatcgtcatcatcgttcagtacctgaactcaaccgagcaggtgggcaccgagaac
caaatcacctgctatgagaacttcacccaagcgcagctggatgtggtgctgcccgtgcga
ctggagctgtgcctggtcctctttttcgtccccatgacagtcaccatcttctgctattgg
cgctttgtatggatcatgctcacacagccccatgttggggctcagaggcgacgccgggcg
gtgggcctggctgtggtgacgcttcttaatttcctggtgtgctttggaccttacaacatg
tcccacctggtggggttccacttgaggcagagtccctcgtggcgggtggaggctgtggtg
ttcagttccctcaatgccagcctggaccctctgctattctacttctcctcctccgtggta
cgcagggccttcgggaaaggtttgctactactccgcaatcccggctcctctatgctgggc
aggggagccgaagagacagtggaggggaccaagacagacaggggtgggagtcaaacagaa
ggggcacagagctctgactttgtcaccgagtga

DBGET integrated database retrieval system