KEGG   Rattus norvegicus (rat): 292808
Entry
292808            CDS       T01003                                 

Gene name
Pepd
Definition
(RefSeq) peptidase D
  KO
K14213  Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    292808 (Pepd)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     292808 (Pepd)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M24
   292808 (Pepd)
SSDB
Motif
Pfam: Peptidase_M24 AMP_N
Other DBs
NCBI-GeneID: 292808
NCBI-ProteinID: NP_001009641
RGD: 1594571
UniProt: Q5I0D7
Position
1q21
AA seq 492 aa
MASTVRPSFSLGNETLKVPLALFALNRQRLCERLRKNGAVQAGSAVVLQGGEEMQRYCTD
TSIIFRQESFFHWAFGVIESGCYGVIDVDTGKSTLFVPRLPASYATWMGKIHSKEHFKEK
YAVDDVQYADEIASVLTSRNPSVLLTLRGVNTDSGNVCREASFEGISKFTVNNTILHPEI
VECRVFKTDMELEVLRYTNRISSEAHREVMKAVKVGMKEYEMESLFQHYCYSKGGMRHTS
YTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGEYYCFASDITCSFPANGKFTD
DQKAIYEAVLRSCRTVMSTMKPGVWWPDMHRLADRIHLEELTRIGLLSGSVDAMLQVHLG
AVFMPHGLGHFLGLDVHDVGGYPEGVERIDEPGLRSLRTARHLEPGMVLTVEPGIYFIDH
LLDQALADPAQACFFNQEVLQRFRNFGGVRIEEDVVVTDSGMELLTCVPRTVEEIEACMA
GCDKALAPSGPK
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgtctaccgtgcgcccttccttctccctggggaatgagaccctgaaggtgccgctg
gcactgttcgccctgaacaggcagcgcctgtgtgagaggctgaggaagaatggagctgtg
caggccggctcagctgtcgtgttgcagggcggggaagagatgcaacgatactgcaccgat
acctccatcatcttccgccaggagtccttctttcactgggccttcggtgtcatcgagtca
ggctgctatggtgtcattgacgtggacactggaaagtcaaccctgtttgtgcccaggctt
cctgccagctatgccacctggatgggaaagatccattccaaggagcatttcaaggagaag
tacgcagtggacgatgtccagtacgcggatgagattgccagtgtcctgacttcacggaac
ccctctgtcctcctcactttgcgcggtgtcaacacagacagtggcaatgtctgcagggag
gcttccttcgagggcattagcaagttcactgtcaacaacacgattcttcacccagagatc
gtggaatgccgagtgttcaagacagacatggagctggaggttttgcgctacacaaatcgg
atctccagtgaggcccaccgtgaggtgatgaaggctgtaaaagtggggatgaaggaatac
gagatggaaagcctgttccagcactattgttactctaaaggtggcatgcgccacacctct
tacacctgtatctgctgcagcggtgagaacgcagccgtgctgcactacggccatgccggg
gcccccaatgaccggacgatcaaggatggagatatttgcctgttcgacatgggtggagag
tactactgcttcgcttctgacatcacctgctccttccctgccaatggcaagttcacagac
gaccagaaggccatctacgaagcagtgctcagaagctgcagaacggtcatgagcactatg
aagccaggtgtctggtggcctgatatgcaccggctggctgaccgcatccacctggaggaa
ctgacacgcattggcctcctgagtggcagcgtggatgcaatgctccaggtccacctggga
gcagtattcatgccacatggactcggccactttctgggcctagatgtgcatgatgtggga
ggctaccctgagggtgtagagcgcatcgatgaacctggcttgcgaagcctgcgtacagca
aggcacctggagccaggcatggtgctgactgtggagccaggcatctacttcattgaccac
ctcctggaccaggccctggcagacccggcccaagcctgcttctttaaccaagaggtccta
cagcgttttcgcaactttggtggggtccgtattgaggaagacgttgtcgtgaccgacagt
ggcatggagctgctgacatgtgtaccccggactgtggaagaaattgaagcatgcatggca
ggctgtgacaaggcccttgcaccctctggcccaaaatag

DBGET integrated database retrieval system