KEGG   Rattus norvegicus (rat): 29284Help
Entry
29284             CDS       T01003                                 

Gene name
Rps14
Definition
(RefSeq) ribosomal protein S14
  KO
K02955  small subunit ribosomal protein S14e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    29284 (Rps14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    29284 (Rps14)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    29284 (Rps14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S11 CBM_25
Motif
Other DBs
NCBI-GeneID: 29284
NCBI-ProteinID: NP_073163
RGD: 62025
Ensembl: ENSRNOG00000018774
UniProt: P13471
Position
18q12.1
AA seq 151 aa AA seqDB search
MAPRKGKDKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGM
KVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALA
RSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcgcaaggggaaggacaagaaggaagaacaggtcatcagccttggacctcag
gtggctgaaggagagaatgtatttggtgtctgccacatctttgcatccttcaatgatacc
tttgtccatgttactgatctttctggcaaggaaaccatttgccgagtaactggtggaatg
aaggtgaaggctgaccgagatgagtcctctccgtatgcagccatgttggctgcccaggat
gtggcccagaggtgcaaggaactgggcatcactgccctgcatatcaaactccgggccaca
ggaggaaacaggaccaagacccctggacctggagcccagtcagccctcagagctcttgct
cgctctgggatgaagattgggcggattgaggatgtcacccccatcccctctgacagcact
cgaaggaagggtggtcgtcggggtcgccgtctgtga

DBGET integrated database retrieval system