KEGG   Rattus norvegicus (rat): 292845Help
Entry
292845            CDS       T01003                                 

Gene name
Etfb
Definition
(RefSeq) electron transfer flavoprotein beta subunit
  KO
K03521  electron transfer flavoprotein beta subunit
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    292845 (Etfb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETF
Motif
Other DBs
NCBI-GeneID: 292845
NCBI-ProteinID: NP_001004220
RGD: 1303312
Ensembl: ENSRNOG00000017851
UniProt: Q68FU3
Position
1q22
AA seq 255 aa AA seqDB search
MAELRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKE
IIAVSCGPPQCQETIRTALAMGADRGIHVEVPGAEAENLGPLQVARVLAKLAEKEKVDLL
FLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETIRLKLPAV
VTADLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKVSVISVEEPPQRLAGVKVE
TTEDLVAKLKEVGRI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgcgcgcgctcgtggctgtcaagagggtcatcgacttcgccgtgaagatt
cgggtaaagcctgacaagtctggagtggtgactgatggtgtgaagcactccatgaacccc
ttctgtgagattgcagtggaagaggctgtgcgactaaaggagaagaagctggtgaaggag
atcattgctgtcagctgtggccccccacagtgccaggagaccatccgaactgctctggcc
atgggcgcagacagaggcatccacgtggaagtgccaggggcagaggcagaaaacttaggc
cccctgcaggtggcccgggtcctggccaagttggctgaaaaggagaaggtggaccttttg
ttcctgggcaagcaggctattgatgatgactgtaaccagacaggtcagatgacagccgga
cttctggactggccgcagggtacattcgcctctcaggtgacactggagggggacaaggta
aaagtggaacgggaaattgacgggggtctggagacgattcgcctgaaactgccagctgtg
gtgactgctgacttaagactcaatgagcctcgctatgccacactgcccaacatcatgaaa
gccaagaagaagaagattgaagtgatcaaggctggagacctgggtgtggacctgacctcc
aaggtctccgtgatcagtgtggaggagccccctcagcgcttagcaggagtaaaggtagag
accacggaagacctggtggccaagctgaaggaggtggggaggatctga

DBGET integrated database retrieval system