KEGG   Rattus norvegicus (rat): 292878
Entry
292878            CDS       T01003                                 

Gene name
Emc10, Inm02
Definition
(RefSeq) ER membrane protein complex subunit 10
  KO
K23570  ER membrane protein complex subunit 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    292878 (Emc10)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   ER membrane protein complex
    292878 (Emc10)
SSDB
Other DBs
NCBI-GeneID: 292878
NCBI-ProteinID: NP_001004221
RGD: 1303214
Ensembl: ENSRNOG00000019532
UniProt: Q6AYH6
Position
1q22
AA seq 268 aa
MALGSSQRFGMVAAGAGVTQLLVLLLMVAAVPSRARGSGCRVGAAARGVGADGHEAEGCG
TVALLLEHSFEIGDGANFQKRGSLLWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRV
RVPRRPGTLDGSEAGGHVSSFVPACSLVESHLSDQLTLHVDVAGNVVGLSVVVYPGGCRG
SEVEDEDLELFNTSVHLRPPGTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYI
IPVVLFLMMSGAPDAGGQGGGGGGGSSR
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcgctcggctcttcccagcgcttcggtatggtggccgcgggtgccggcgtgacccag
ctgctagtgctcttgttgatggtagccgcggttcctagcagagcccggggcagcggctgc
cgggtcggagccgccgcgcgcggggtgggagctgatggccatgaagctgagggctgtggc
actgtggcattgctgctggaacattcatttgagattggtgatggcgccaacttccagaag
cgtggctctctgctctggaaccagcaggacggcaccttgtcggcgacacagcgacagctc
agcgaggaagagcggggccgactccgggatgtggctgctgtcaatggcctctacagggtt
cgggtcccaaggcggcctgggacacttgatggttcagaagctggtggccacgtgtcttcc
tttgtcccagcgtgttccctggttgagtcacatctctcggaccagctgaccttgcacgtg
gatgtggctggcaacgtggtaggcctgtcggtggtagtgtaccccgggggctgccggggc
tctgaggtggaagatgaggacctggagctgttcaatacatctgttcatctgcggcctcca
ggcaccgctccaggccccgagacggcggccttcattgagcggctggagatggagcaggcc
cagaaggccaagaatcctcaggaacagaagtctttctttgccaaatactggatgtacatc
attccagtcgtgctgttcctcatgatgtcgggagcgccggacgccgggggccagggcggt
ggtgggggtgggggcagcagccggtga

DBGET integrated database retrieval system