KEGG   Rattus norvegicus (rat): 292878Help
Entry
292878            CDS       T01003                                 

Gene name
Emc10, Inm02
Definition
(RefSeq) ER membrane protein complex subunit 10
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 292878
NCBI-ProteinID: NP_001004221
RGD: 1303214
Ensembl: ENSRNOG00000019532
UniProt: Q6AYH6
Position
1q22
AA seq 268 aa AA seqDB search
MALGSSQRFGMVAAGAGVTQLLVLLLMVAAVPSRARGSGCRVGAAARGVGADGHEAEGCG
TVALLLEHSFEIGDGANFQKRGSLLWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRV
RVPRRPGTLDGSEAGGHVSSFVPACSLVESHLSDQLTLHVDVAGNVVGLSVVVYPGGCRG
SEVEDEDLELFNTSVHLRPPGTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYI
IPVVLFLMMSGAPDAGGQGGGGGGGSSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcggctcttcccagcgcttcggtatggtggccgcgggtgccggcgtgacccag
ctgctagtgctcttgttgatggtagccgcggttcctagcagagcccggggcagcggctgc
cgggtcggagccgccgcgcgcggggtgggagctgatggccatgaagctgagggctgtggc
actgtggcattgctgctggaacattcatttgagattggtgatggcgccaacttccagaag
cgtggctctctgctctggaaccagcaggacggcaccttgtcggcgacacagcgacagctc
agcgaggaagagcggggccgactccgggatgtggctgctgtcaatggcctctacagggtt
cgggtcccaaggcggcctgggacacttgatggttcagaagctggtggccacgtgtcttcc
tttgtcccagcgtgttccctggttgagtcacatctctcggaccagctgaccttgcacgtg
gatgtggctggcaacgtggtaggcctgtcggtggtagtgtaccccgggggctgccggggc
tctgaggtggaagatgaggacctggagctgttcaatacatctgttcatctgcggcctcca
ggcaccgctccaggccccgagacggcggccttcattgagcggctggagatggagcaggcc
cagaaggccaagaatcctcaggaacagaagtctttctttgccaaatactggatgtacatc
attccagtcgtgctgttcctcatgatgtcgggagcgccggacgccgggggccagggcggt
ggtgggggtgggggcagcagccggtga

DBGET integrated database retrieval system