KEGG   Rattus norvegicus (rat): 292889
Entry
292889            CDS       T01003                                 

Gene name
Med25, RGD1305137
Definition
(RefSeq) mediator complex subunit 25
  KO
K15168  mediator of RNA polymerase II transcription subunit 25
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    292889 (Med25)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Other mediators
     292889 (Med25)
SSDB
Motif
Pfam: Med25_VWA Med25_SD1 Med25 Med25_NR-box
Other DBs
NCBI-GeneID: 292889
NCBI-ProteinID: NP_001163897
RGD: 1305137
Ensembl: ENSRNOG00000020363
UniProt: D3ZJW8
Position
1q22
AA seq 746 aa
MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGD
YGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLST
ALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTESLVQKIGERGIHF
SIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLVRGLVLPVGGSSAPGPLQ
PKQAVPLPPAPTSAATLSAAPQQTLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLG
PRFSPINPLQQAASGVGPPFSQAPAPPLAPGPPGAPKPPPASQPSLVSTVAPGPGLAAPA
QPGAPSMQAGTVTPGGVSGPSPAQLGGPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDA
NTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKD
LESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQ
VITNHKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPPQNLLQLRAPQPQPQGAVGASA
ATGQPQPQGTTQAPTGAPQGPPGAAPGPPPSGPILRPQNPGANPQLRSLLLNPAPPQTGV
PPPQASLHHLQPPGAPALLPPHQSLGQPQLGPQLLHPPPTQSWPTQLPQRAPLPGQMLLS
GGPRGPVPQPGLQPSVMEDDILMDLI
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggtccccggatccgaaggcccggcccgggccgggggcctggtcgctgatgtggtgttt
gtgatcgaggggacggcaaacctggggccgtacttcgagggactccgcaagcactacctg
ctgcccgccatagagtacttcaacggaggaccacccgcagagacggactttgggggagac
tatggcggaacccagtacagccttgtggtgttcaacacagtagactgcgctccagagtcc
tatgtacaatgccatgctcctaccagcagtgcctatgagtttgtcacctggctcgatggc
atcaagttcatgggtggtggtggcgagagctgcagtctcattgctgaaggtctgagcact
gctctgcagctgtttgatgacttcaagaagatgcgtgaacagatcggccagacccaccga
gtctgtctcctcatctgcaactcccccccatacctactgcctgccgtggagagcaccaca
tactcaggctgtacgacggagagcctggtgcagaagataggagagcgtggtatccacttc
tccatcgtttctccaagaaagctgccagcacttaggcttctgtttgagaaggcggctcct
cctgccctactggagccattgcagcccccagcagacgtcagccaggaccccaggcacatg
gtacttgtgcgtgggctcgtgctgcctgttggcggcagctcagccccaggccctctgcag
cccaagcaagccgttcccctgccaccagctccaacttcagctgccacgctctcagcagcc
ccccagcagaccctgcccccggtcccaccacagtaccaggtccctgggaacctaagtgct
gctcaggtggctgcgcagaatgctgtggaggctgccaagaaccagaaggccgggctgggc
ccacgcttctcacccatcaaccctctccagcaagctgcttcaggagtggggccccccttc
agccaggccccggcacccccattagctcctgggccccctggagctcccaagccacctcct
gcctcacagcctagcctagtctccactgtggcccctggaccaggcctggcagccccggct
cagcctggggctccgtctatgcaggcaggcactgtgaccccaggtggggtcagtggtcct
tcaccagcccagctggggggtcctgcacttggtgggcaacagtcagtatccaacaagctc
ctagcctggagtggcgtccttgagtggcaggagaaacccaagcctgcatccgtggatgcc
aacaccaagctgacaaggtctctgccttgtcaggtctatgtgaaccatggagaaaacctg
aagactgagcaatggccccagaaactgatcatgcagctcatccctcagcaactgctgacc
accctgggcccgctgttccggaactcgagaatggtccagttccacttcaccaacaaggac
ctggagtccctcaaaggcctctaccgcatcatgggcaatggctttgccggctgcgtgcac
ttcccacatacagccccgtgcgaggtgcgcgtgctcatgctcctgtactcgtctaagaag
aagatcttcatgggcctcatcccctacgaccagagtggcttcgtcaatggcatccgccag
gtcatcaccaaccataagcaggtccagcagcagaagctagagcagcagcgtgggatgggg
gcacagcaggcacctccaggcctgggccccattctggaggaccaagcgaggcccccgcag
aatctattacagctccgtgcaccacagcctcagcctcagggtgctgtgggagcttctgcg
gctacagggcagccccagccccaaggtactacccaggccccaacaggggcaccccaaggt
cctcctggagcagcccctggcccacctccttctggacccatccttcgaccccagaaccct
ggagccaacccccagctgcggagccttctccttaatccagcaccgccccagactggggta
cccccaccccaggcctccctacaccacctccagcctccaggggcccctgcattgctgccg
ccacatcagagcctggggcagccgcagctagggccgcaactcctgcaccctccacctacc
cagtcttggcccacacagctaccccagagggcgccactgccaggtcagatgctgctgagc
gggggtccccggggcccggttccccagccgggcctgcagcccagcgtcatggaggacgac
atcctcatggacctcatctga

DBGET integrated database retrieval system