KEGG   Rattus norvegicus (rat): 292890
Entry
292890            CDS       T01003                                 

Gene name
Tsks, Stk22s1
Definition
(RefSeq) testis-specific serine kinase substrate
  KO
K16492  testis-specific serine kinase substrate
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    292890 (Tsks)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    292890 (Tsks)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     292890 (Tsks)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    292890 (Tsks)
SSDB
Motif
Pfam: TSKS DUF4407 GAS zf_CopZ AAA_13
Other DBs
NCBI-GeneID: 292890
NCBI-ProteinID: NP_954519
RGD: 727784
Ensembl: ENSRNOG00000020443
UniProt: P60531
Position
1q22
AA seq 585 aa
MASVVVKTIWQSKEIHEAGDPPAGVESRAQLVPEAPGGVTSPAKGITKKKKAVSFHGVEP
RMSHEPMHWCLNLKRSSACTNVSLLNLAAMEPDSSGTDSTTEDSGPLALPGPPASPTTPW
APEDPDITELLSGVNSGLVRAKDSITSLKEKTTRVNQHVQTLQSECSVLSENLERRRQEA
EELEGYCSQLKGPRPDVLTQENCRKVTRSVEDAEIKTNVLKQNSALLEEKLRYLQQQLQD
ETPRRQEAELQELEQKLEAGLSRHGLGPTTPIQGCSGPPGSPEEPPRPRGLPSNGWGMAI
RAGEGPSLSEQELQKVSSGLEELRREVSSLAARWHQEEGAVQEALRLLGGLGGRLDGFLG
QWERAQREQAQSARGLQELRGRADELCTMVERSAVSVASLRSELEALGPVKPILEELGRQ
LQNSRRGPDHVLNLDRPAQGPCPRCASQGQQLSTESLQQLLERALTPLVDEVKQKGLAPA
CPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEAVRAKNLLLTDKMKPEEKVATL
DYMHLKMCSLHDQLSHLPLEGSTGAMGGGSTGGAPPKRGGPGSEQ
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggcaagcgtggtggtgaagacaatctggcaatccaaagagatccacgaagcgggggac
ccacctgcgggggtggagagccgcgcccagctggtccccgaagctcccgggggggtgacc
agccctgccaaggggataacaaagaaaaagaaggccgtgtccttccatggggtggagccc
cggatgtcccacgagccgatgcactggtgcctgaacctcaagcggtcctcagcctgcacc
aacgtgtccttgctcaacctggctgccatggagcccgactcctccggtacagactcgacc
acagaggacagtggtccactggcactgccagggccacctgcttcccctacaacaccctgg
gctccagaggaccctgacatcacagaactactgagtggggtcaacagtggattggtacgt
gccaaagactccatcaccagcttgaaggaaaagaccacgcgggttaatcagcatgttcag
acactgcagagcgagtgctctgtgctgagtgagaatctggaaagaaggcggcaggaggca
gaagagttggaggggtactgcagtcaattgaagggcccccgccctgatgttctgacccag
gagaactgccgcaaggtgacccgttcagtggaagacgctgaaatcaaaaccaatgtcctg
aagcagaactctgccttgttggaggagaagctaagatacctccagcagcaactgcaggat
gagacgccccggagacaggaggccgagttgcaggagctggagcaaaaactagaggctggc
ctctcccggcatggcctaggccctactactcccattcagggctgctccggtcctcctggt
agcccggaggaacccccgcggccgcgaggcctgccctccaatggctggggcatggcaatc
cgcgcaggggagggaccctcgctgagcgagcaggagttgcagaaggtctccagcggccta
gaggagctgaggagggaggtgtcctcgctggcagctcggtggcatcaggaggagggggcg
gtgcaggaggccctaaggttgctgggaggcctgggcggccgtctggatggctttctgggc
caatgggagcgggcgcagcgggaacaagcacagtccgcacggggtttgcaggagctgcga
ggacgagcagatgagctgtgcactatggtggagaggtcagcagtgtctgtcgcttcactg
aggagcgaactggaggcactgggcccagtaaaaccgattctggaggagctgggacggcaa
cttcaaaactcccgaaggggacctgaccatgtcttgaacttggatcgtcctgcccaaggt
ccctgtcctcgatgtgccagccaggggcagcagttatccacggagtccctacagcagctg
ctggaacgtgcgctgaccccactggtggacgaagtgaagcagaagggtctggctcctgcc
tgccccagttgccagaggctacacaagaagattctggagctggagcgccaggccttggcc
aaacacgtcagggcagaggccctgagctccacccttcggctggcccaagacgaagccgtt
cgggccaagaacctactgctgacggacaagatgaagccggaggagaaggtggccactttg
gactatatgcatttgaagatgtgttccctccacgaccaactcagccacctgccacttgag
gggtccacaggggcaatggggggaggaagcactggaggggctccccctaaacgtgggggt
ccaggctctgaacaataa

DBGET integrated database retrieval system