KEGG   Rattus norvegicus (rat): 292892
Entry
292892            CDS       T01003                                 

Gene name
Irf3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05133  Pertussis
rno05135  Yersinia infection
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    292892 (Irf3)
   04621 NOD-like receptor signaling pathway
    292892 (Irf3)
   04622 RIG-I-like receptor signaling pathway
    292892 (Irf3)
   04623 Cytosolic DNA-sensing pathway
    292892 (Irf3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    292892 (Irf3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    292892 (Irf3)
   05133 Pertussis
    292892 (Irf3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    292892 (Irf3)
   05162 Measles
    292892 (Irf3)
   05164 Influenza A
    292892 (Irf3)
   05161 Hepatitis B
    292892 (Irf3)
   05160 Hepatitis C
    292892 (Irf3)
   05168 Herpes simplex virus 1 infection
    292892 (Irf3)
   05163 Human cytomegalovirus infection
    292892 (Irf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    292892 (Irf3)
   05169 Epstein-Barr virus infection
    292892 (Irf3)
   05165 Human papillomavirus infection
    292892 (Irf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    292892 (Irf3)
   04131 Membrane trafficking [BR:rno04131]
    292892 (Irf3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    292892 (Irf3)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    292892 (Irf3)
SSDB
Motif
Pfam: IRF-3 IRF YoeB_toxin
Other DBs
NCBI-GeneID: 292892
NCBI-ProteinID: NP_001006970
RGD: 1549774
Ensembl: ENSRNOG00000043388
UniProt: Q5XIB0
Position
1q22
AA seq 421 aa
MGTPKPLILPWLVSQLDLGQLKGVAWLDESRTKFRIPWKHGLRQDAQMADFGIFQAWAEA
SGAYTPGKDKPDLSTWKRNFRSALNRKEVLRLAEDRSKDPFDPHKVYEFVTPGGARDFVH
LDTSPDTNGKSSLSDHQEDLLELLDHMALGPLPDEGSSDLPIASDPSQPPLSPIVNNFPN
PAPQENPLRQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTSDNGTLPWQPVTL
PDPEEFLTDRLVREYVRQVLKGLGKGLVLWRAGQCLWAQRLGHSHSFWALGEELLPDSGR
GPDGEVPKDKNGVVFDLRPFVADLIAFMEGSRHSPRYTLWFCVGESWPQDQPWVKRLVMV
KVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKACLQDLVEDMDFQATGE
T
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggaaccccgaaaccgctgattttgccttggctggtgtctcagctggacctgggacag
ctgaaaggtgtggcctggctggacgagagccgtacaaagttcaggatcccatggaagcat
ggcttacgacaggacgcacagatggctgactttggcatcttccaggcctgggcggaagcc
agtggtgcctacaccccagggaaggataagccagacctgtcaacctggaagaggaatttc
cggtcagccctgaaccggaaagaagtgttgcgattagctgaggaccggagcaaggaccct
tttgaccctcataaagtgtatgagtttgtgactccaggaggagcaagggactttgtacat
ctggacacctcccctgacaccaatggcaaaagcagtctgtctgatcaccaggaagacctc
ttggaattactcgatcacatggccttgggacccctcccagatgaggggtcctcagacctg
cctattgcttctgatccttctcaaccaccactaagccccattgtaaacaacttcccaaac
ccagcaccccaggaaaacccactaaggcagctgctagctgaggaacagtgggagttcgag
gtgactgccttctaccgaggccgccaggtcttccagcagacactcttttgccccgggggc
ctgcggctggtgggcagcacgtctgacaacgggacactgccctggcagccagtcaccctg
ccagaccctgaggagtttctgacagacaggcttgtgagggagtatgtgaggcaggtactc
aaggggctgggcaaggggctggtgctgtggcgggcagggcagtgcctctgggcccagcgc
ctaggccactcgcattccttctgggccctgggtgaggagctgcttccagacagtgggaga
gggcctgatggagaggtccccaaggacaagaacggagtcgtgttcgacctcaggcccttt
gtggcagatctcattgccttcatggaaggaagcagacattccccacgatacactctgtgg
ttctgtgtgggggaatcgtggccccaggaccagccgtgggtcaagaggcttgtgatggtc
aaggttgttcctacatgtcttaaggagctgttagagatggcccgggaagggggagcctca
tcactgaaaaccgtggacttgcacatctccaacagccagccgatctcccttacctctgac
cagtacaaggcctgcctccaggacttggtggaagacatggacttccaggccactggagaa
acctga

DBGET integrated database retrieval system