KEGG   Rattus norvegicus (rat): 29290Help
Entry
29290             CDS       T01003                                 

Gene name
Adora1
Definition
(RefSeq) adenosine A1 receptor
  KO
K04265  adenosine receptor A1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04923  Regulation of lipolysis in adipocytes
rno04924  Renin secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    29290 (Adora1)
   04024 cAMP signaling pathway
    29290 (Adora1)
   04022 cGMP-PKG signaling pathway
    29290 (Adora1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29290 (Adora1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    29290 (Adora1)
   04924 Renin secretion
    29290 (Adora1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    29290 (Adora1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    29290 (Adora1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx CcmH
Motif
Other DBs
NCBI-GeneID: 29290
NCBI-ProteinID: NP_058851
RGD: 2048
Ensembl: ENSRNOG00000003442
UniProt: P25099
Position
13q13
AA seq 326 aa AA seqDB search
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacatctcggccttccaggctgcctacattggcatcgaggtgctcattgcc
ttggtctctgtgcccggaaatgtactggtgatttgggctgtgaaggtgaaccaggcactt
cgcgatgccaccttctgcttcatcgtgtcactggcggtagctgatgtggccgttggcgcc
ctggtcatcccactggccatccttatcaacattgggccacagacctacttccacacctgc
ctcatggtggcctgccctgtcctcatcctcacccagagctccattctggctctgctcgcc
attgctgtggatcgatacctccgagtcaagatccctctccggtacaagacagtggtgacc
cagcggcgggcggcagtggccatagctggctgctggattctctcccttgtggtaggcctg
acacccatgtttggctggaacaacctgagtgtggtagagcaagactggagagccaacggc
agtgttggggagcccgtgatcaagtgtgagtttgagaaggttatcagcatggagtacatg
gtctacttcaacttcttcgtctgggtgctgccgccactgctcctcatggtcctcatctac
ctggaggtcttctacctgatccgtaagcagctcaacaaaaaggtgtcagcctcctccggt
gacccccagaagtactacgggaaggagctgaagatcgccaagtcgctggccctcatcctc
ttcctctttgccctcagctggctgccgctgcatatcttgaactgtatcaccctcttctgc
cccacctgccagaaacccagcattctgatctacatcgccatcttcctcacacacggcaac
tccgccatgaaccccatcgtctatgccttccggatccacaagttccgggtcacctttctg
aagatttggaatgaccacttccgatgccagcctaagcctcccatcgatgaagacctccca
gaggagaaagctgaggactag

DBGET integrated database retrieval system