KEGG   Rattus norvegicus (rat): 292905
Entry
292905            CDS       T01003                                 

Gene name
Hrc
Definition
(RefSeq) histidine rich calcium binding protein
  KO
K23450  sarcoplasmic reticulum histidine-rich calcium-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    292905 (Hrc)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    292905 (Hrc)
SSDB
Motif
Pfam: Hist_rich_Ca-bd
Other DBs
NCBI-GeneID: 292905
NCBI-ProteinID: NP_852034
RGD: 727864
Ensembl: ENSRNOG00000020719
UniProt: Q80W59
Position
1q22
AA seq 755 aa
MGFQEPWLYSCLLWATVAILLVPPVVTQELRGTGLGLGNWNNNAGIPGSSEDLSTEYGHH
IHSHGAYQGEKDRHHREEDEDFSREYGHQVQDHRYPGHEVGEENVSEEVFRGHVRQLHGH
HKPNSEDLGDSAESHFPRQQSHNREEEDGVVSGEDHRHIPRHDHHGNEEEDDDGEEEERV
GVMENSDDKHQAHGHHSHSKERDGLHHAHSHRHQGHHDEDDDDEDGVSTEGEHQAHRYQD
HDEEDDDDSDEESHAHRLQGQEDENDDEDGDSSENGHQTQDHQGHKEQDDDDDEEEEEEE
EEEEEEEEEEEEEEEEDDDDDSTEHRHRHQTQGHRKGKDEDESDEDDHVTRHGRRGHEDE
DDDDDDDDDDDDDNDGGSTENVHQAHRHRGHEHEDDGDDSEEDYHHVPSHGHQSHQNEEE
EDEAVSTEHWHQSPRHAHHDLGRENQEEATVKYSRHVASHRPQGHSAEEDSLEDSTNEVP
GHHHHRVSRDGDEDISTEFGHKAPRHRLQDQDEWTRQGHGKSVQEDIGHQPLQPTGPGSG
ESRKEDDHSSQEGDEDLKQRQEAHSEEEEEEEEGHGLPMSLEDEEEEEKDKKESKGDRAA
VSAPLSHHRKHDDDDDGDGDDDDDDNDDDDEILEENLLPFTIIPNPLAGREVAREGSSEE
ESREVTGQQDAQEYENYQPGSLCGYCSFCNRCSECESCHCDEENMGEHCDQCQHCQFCYL
CPLVCDTLCTPGSYVDYFSSSVYQAVADMLETQEP
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgggcttccaggagccatggttgtacagttgtctcctttgggccacagtggccatcctg
ctggtccctccagtggtgacccaggagctgagagggactgggctgggcctcggcaactgg
aacaacaacgcaggtatccctgggtcctcagaggacctatcaactgagtatggtcaccac
atccacagccacggggcctatcaaggtgagaaggacagacaccacagagaagaagatgaa
gacttctccagggaatatggccaccaagtccaagaccacaggtaccctggccatgaagtt
ggggaggagaatgtctcagaagaggtcttcagagggcatgttagacagctccatgggcac
cacaaacctaacagtgaagatttaggggactcagcagagagccacttccccagacagcag
agccacaaccgtgaagaagaggacggcgttgtctccggtgaggatcaccgtcacatcccc
aggcatgaccaccatggcaacgaagaggaggatgatgatggagaggaggaggagagggtg
ggagtgatggagaactctgatgataagcaccaggcccacggccaccacagccactcaaaa
gaaagagatggactccatcatgcccacagccacaggcaccaagggcaccatgatgaagat
gatgatgatgaagatggtgtctccactgagggtgaacaccaagctcacagatatcaagac
catgatgaggaagacgatgatgactcagatgaagagagtcatgcccacagacttcaaggc
caagaagatgaaaatgatgatgaagatggtgactccagtgaaaatggacaccagacccag
gaccaccaaggccataaagaacaagatgatgatgacgatgaagaagaagaagaagaagaa
gaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagacgatgacgac
gactccactgagcacaggcacaggcaccagacccaaggccacaggaagggaaaagatgag
gatgagtcagatgaagatgatcatgtcacccggcatggccgccgaggccatgaagatgaa
gatgatgacgatgacgatgacgatgacgatgatgacgacaatgatggtggctctactgag
aatgtgcaccaagcccacagacacagaggccatgagcacgaagacgatggggatgactca
gaagaagactaccatcatgtccccagccatggtcaccaaagccatcaaaatgaggaagag
gaagatgaggctgtctccactgaacactggcaccagtctcctagacatgctcaccatgat
cttggacgtgagaatcaagaagaggcaacagtcaagtacagccgccatgttgcaagccat
cgaccccaaggccacagtgcggaggaggactctctagaagactctaccaatgaagtccct
ggacatcaccaccacagagtctccagggatggcgacgaagacatttctactgagtttggc
cacaaggcccccagacacaggctacaagatcaagatgaatggaccaggcagggtcacgga
aaatctgtccaggaagacattggtcatcagcccctgcagcccacaggtcctggttctgga
gaatcaaggaaggaagatgaccacagctctcaagagggagatgaggacttaaagcagaga
caagaagcccacagtgaggaggaggaggaggaagaggagggccatggcctccccatgagc
ctggaagatgaagaggaggaagaaaaagataagaaagagagcaagggagacagggctgca
gtttcggctccactgagtcatcacaggaagcatgatgatgatgatgacggcgacggtgat
gatgatgatgacgacaatgacgacgatgatgagatcctggaggaaaacctgctacctttc
accattatcccaaacccactggctgggagggaggtggccagagaaggttccagtgaggag
gagagccgcgaggtcacaggtcagcaggatgcccaggagtatgagaactaccagccaggg
tccctgtgtggctactgttctttctgcaaccgatgtagtgaatgtgaaagctgccactgt
gatgaggagaacatgggggaacactgtgaccagtgtcagcactgccaattctgctacctc
tgcccgctggtctgtgacacactctgcactccaggaagctacgttgactatttctcctcc
tctgtgtatcaagctgtggctgacatgctggagacgcaagagccctga

DBGET integrated database retrieval system