KEGG   Rattus norvegicus (rat): 292949Help
Entry
292949            CDS       T01003                                 

Gene name
Perp
Definition
(RefSeq) PERP, TP53 apoptosis effector
  KO
K10136  TP53 apoptosis effector
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    292949 (Perp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 292949
NCBI-ProteinID: NP_001099735
RGD: 1310294
Ensembl: ENSRNOG00000011994
UniProt: B2GVC0
Position
1p12
AA seq 193 aa AA seqDB search
MLRCGLACERCRWILPLLLLSAIAFDIIALSGRGWLQSSNHIQTSSLWWRCFDEGGGSGS
YDDGCQSLMEYAWGRAAAATLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctgcggcctggcctgcgagcgctgcaggtggatcctgcccctgctgctgctc
agtgccatcgccttcgacatcatcgcgctgtccggccgcggctggctgcagtctagcaac
cacatccagacgtcctcgctttggtggaggtgtttcgacgagggcggtggcagcggctcc
tacgacgatggctgccagagcctcatggaatacgcctggggccgagcagctgctgccact
ctcttctgtggattcatcatcctggtcatctgcttcatcctctcgttcttcgccctgtgt
ggaccccagatgcttgttttcctgagagtgattggaggccttctcgcactggctgctgta
ttccagatcatctccctggttatctatcccgtgaagtacacacaaaccttcaggcttcat
gataatcccgctgttaattacatctacaactgggcctatggcttcggatgggcagccacg
atcatcttgattggttgctctttcttcttctgctgcctccccaactacgaggatgacctt
ctgggcaatgcaaagcccaggtacttctatacatctgcctaa

DBGET integrated database retrieval system