KEGG   Rattus norvegicus (rat): 29298Help
Entry
29298             CDS       T01003                                 

Gene name
Cyp2c7, Cyp2c39
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 7
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    29298 (Cyp2c7)
   00590 Arachidonic acid metabolism
    29298 (Cyp2c7)
   00591 Linoleic acid metabolism
    29298 (Cyp2c7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    29298 (Cyp2c7)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    29298 (Cyp2c7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29298 (Cyp2c7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    29298 (Cyp2c7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     29298 (Cyp2c7)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   29298 (Cyp2c7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 29298
NCBI-ProteinID: NP_058854
RGD: 620379
Ensembl: ENSRNOG00000021405
UniProt: P05179
Position
1q31
AA seq 490 aa AA seqDB search
MDLVTFLVLTLSSLILLSLWRQSSRRRKLPPGPTPLPIIGNFLQIDVKNISQSLTKFSKT
YGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGRGSYPMNENVTKGFGIVFSNGNRW
KEMRRFTIMNFRNLGIGKRNIEDRVQEEAQCLVEELRKTKGSPCDPSLILNCAPCNVICS
ITFQNHFDYKDKEMLTFMEKVNENLKIMSSPWMQVCNSFPSLIDYFPGTHHKIAKNINYM
KSYLLKKIEEHQESLDVTNPRDFVDYYLIKQKQANNIEQSEYSHENLTCSIMDLIGAGTE
TMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSPCMQDRKHMPYTDAMIHEVQRFIN
FVPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFK
KSDYFLPFSAGKRACVGEGLARMQLFLFLTTILQNFNLKSLVHPKDIDTMPVLNGFASLP
PTYQLCFIPS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtcactttcctggtacttactctctcctctctcattctcctctcactctgg
agacagagctctaggagaaggaagctccctcctggccccactcctctcccaataattggt
aatttcctccagatagatgtgaagaacatcagccaatccttaaccaagttttcaaaaacc
tatggccctgtgttcactctgtatttgggctcacagcccactgtcatattgcatggatat
gaagcaataaaggaagctctgattgataacggggagaagttttctggtagaggaagctat
ccaatgaatgaaaatgttactaaaggttttggcattgtttttagcaatggaaacagatgg
aaagagatgagacgattcacaatcatgaactttcggaatttgggaattggaaaaaggaac
attgaggaccgtgttcaagaggaagcacagtgcctagtggaagaactgaggaaaacaaaa
ggctcaccctgtgacccctccttgatcctgaactgtgctccatgcaatgtcatctgctcc
attactttccagaatcattttgattataaagataaggaaatgcttacgttcatggaaaaa
gtgaatgagaatctcaagattatgagctccccatggatgcaggtctgcaatagttttcct
tcactcattgactattttcctggaactcatcacaaaatagcaaaaaatattaattatatg
aaaagctatttgttgaagaaaatagaagaacaccaggaatcattggatgttacaaaccct
cgtgattttgttgattattacctgattaaacaaaaacaggcaaacaacatcgaacaatca
gaatattcacatgaaaatctgacatgcagtatcatggatctcattggtgcagggacagag
acaatgagcacaacattgagatatgctctcctgcttctgatgaagtacccacatgtcaca
gctaaagtccaggaagagattgaccgtgtgattggcagacatcgcagcccctgcatgcag
gatagaaaacacatgccctacactgatgccatgattcatgaggtacagagattcattaac
tttgtcccgaccaacctgccccatgcagtgacctgtgacattaaattcaggaactacctc
atcccgaagggaacaaaagtgttaacatcactgacatcagtgctgcatgacagcaaggag
ttccccaacccagagatgtttgaccctggccactttctagatgagaatggaaactttaag
aaaagtgactactttttgcctttctcagcaggaaaacgagcttgtgttggagagggcctg
gcccgcatgcagttgtttctattcttgacaaccattttacagaactttaacctgaaatct
ctggttcacccaaaggacattgatacgatgccagttctgaatggttttgcctctctgcca
cccacttaccagctctgcttcattccttcctga

DBGET integrated database retrieval system