KEGG   Rattus norvegicus (rat): 292999Help
Entry
292999            CDS       T01003                                 

Gene name
Chsy1
Definition
(RefSeq) chondroitin sulfate synthase 1
  KO
K13499  chondroitin sulfate synthase [EC:2.4.1.175 2.4.1.226]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
rno01100  Metabolic pathways
Module
rno_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    292999 (Chsy1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    292999 (Chsy1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     292999 (Chsy1)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     292999 (Chsy1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   292999 (Chsy1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHGN Fringe Glyco_transf_7C Glyco_tranf_2_2 Galactosyl_T Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 292999
NCBI-ProteinID: NP_001099738
RGD: 1311904
Ensembl: ENSRNOG00000012698
UniProt: D3ZRM3
Position
1q22
AA seq 788 aa AA seqDB search
MLLGLVLGFVLASRLVLPRASELKRVGPRRRPNPEGCRPGQAASQPGGAPGDARGAQLWP
QGSAAEGVPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVEFFSSEGSDTSIPIP
VVPLRGVDDSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDRLESFLRSLNSSE
PLFLGQTGLGTTEEMGKLALEPGENFCMGGPGVILSREVLRRMAPHIGKCLREMYTTHED
VEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYIRDLHSSKIHRAITLHPNKNPPYQ
YRLHSYMLSRKIAELRHRTIQLHREIVLMSKYSSTEIQKEDLQLGIPPSFMRFQARQREE
ILEWEFLTGKYLYSATEGQPPRRGMDSAQREALDDIVLQVMEMINANAKTRGRIIDFKEI
QYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKIQFVEHEGLDAQE
LADRINQDSGSLSFLSNSLKKLVPFQLPGSKMEHKEPKEKKINILIPLSGRFDMFVRFMG
NFEKTCLIPNLNVKLVILLFNSDSNPDKAKQVELMRDYRVKYPKADMQVLPVSGGFSRAL
ALEVGSSQFSNESLLFFCDVDLVFTAEFLQRCRANTVLGQQIYFPIIFSQYDPKIVYSGK
VPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLEDVDLFNKVVQAGL
KTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTFGSTQQLAEMWLEKNDPSYSRG
GNGSARTV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgggctcgtgctgggcttcgtgctggcctcgcgactcgtcctgccccgcgcc
tcggagctgaagcgagtgggcccgcggcggcgccccaatcccgagggatgccggccagga
caggcagcgtcgcagcccggcggtgctccgggggatgcgcgcggggcgcagctctggccg
cagggctcggccgcggagggcgtcccgcgcgacaggaactttctcttcgtgggagtcatg
accgcccagaaatacctgcagactcgcgccgtggccgcttacagaacatggtccaagaca
attcccgggaaggttgagttcttctctagtgagggttcagacacatctatacccattcca
gtagtgccactgaggggtgtggacgactcctatcccccccagaagaagtctttcatgatg
ctcaagtacatgcacgatcactacttggacaagtacgaatggtttatgagagcagatgat
gatgtctacatcaagggagatcgtctggagagctttctgaggagtttgaatagcagcgag
cccctctttctcgggcagacaggactgggcaccactgaagaaatggggaaactggctctt
gagcctggagagaacttctgcatggggggacctggtgtgattctgagccgggaagtgctt
cggagaatggcaccacacattggcaagtgtctccgggaaatgtacaccacccacgaggat
gtagaggtggggaggtgcgtccggagattcgcaggcgtgcagtgcgtctggtcatatgag
atgcagcagcttttttacgagaattatgaacagaacaagaaagggtacattagagatctc
catagcagtaaaatccaccgagcgatcactttacaccccaacaaaaacccgccctaccag
tacaggctacacagttacatgctcagccgcaagatcgctgagctgcgccatcgcacaatc
cagctgcaccgggagatcgtcctgatgagcaagtacagcagcacggaaatccagaaggaa
gacctccagctgggcatccctccctccttcatgcgctttcaggcccgccagcgagaggag
atcctggagtgggagtttctgactgggaaatacttatattcagccacggaaggccagcct
ccccggagagggatggactcagcgcagagggaggccttggatgacattgtcctgcaagtg
atggagatgatcaatgccaatgccaagacccggggccgcatcatcgacttcaaggagatc
cagtatggctacagacgcgtgaatcccatgtacggggcagagtacatcctggatctgctg
ctcctgtataagaagcacaaagggaagaagatgacggtccctgtgaggaggcacgcgtac
ctgcagcagaccttcagcaagatccagtttgtggagcatgagggcctggatgcacaagag
ctcgctgacagaatcaaccaggactctgggtccctgtcattcctctccaattccttgaag
aagctcgttcccttccagcttcctggatccaagatggagcacaaagagcccaaagaaaag
aagataaacattctgatccctttgtctggacgcttcgacatgtttgtgaggttcatggga
aactttgagaagacgtgtctcattccaaatctgaacgtgaagctggtcattctgcttttc
aattctgactctaaccccgacaaggccaagcaggtcgagctgatgcgagattaccgagtc
aagtacccgaaggctgacatgcaagttttgcctgtgtctggagggttttcgagagcactg
gccctagaagtaggctcttcgcagtttagtaatgagtctctgctcttcttctgtgatgtg
gacctggtgtttacagcggagttcctgcagaggtgccgagccaacactgtgctgggccag
cagatctacttcccaatcatctttagccagtacgatccaaagattgtctatagtgggaag
gttcccagtgacaaccattttgcctttactcaaaaaaccggcttctggagaaactatggg
tttggcattacttgtatctataagggagatcttgtcagagtgggaggcttcgatgtctcc
atccagggctgggggctggaggatgtggacctctttaacaaggtcgtccaggcaggattg
aagacattccggagccaggaggtcggggttgttcacgtccaccaccctgtcttctgtgac
ccgaatctggaccccaagcagtataaaatgtgcctggggtcgaaggcgtcaacattcggg
tccacacagcagttggctgaaatgtggctggagaagaatgaccccagttacagcagaggc
ggcaacggctcggccaggacagtctga

DBGET integrated database retrieval system