KEGG   Rattus norvegicus (rat): 293019
Entry
293019            CDS       T01003                                 

Gene name
Arrdc4, Ab1-209, LRRG00117
Definition
(RefSeq) arrestin domain containing 4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Arrestin_C Arrestin_N
Other DBs
NCBI-GeneID: 293019
NCBI-ProteinID: NP_001041318
RGD: 1311763
Ensembl: ENSRNOG00000010775
UniProt: Q7TP90
Position
1q22
AA seq 300 aa
MSSQSSILVDFRPLATSFTGKYGSIQYCVRAVLERPQVPDQSVRRELQVVSHVDVNTPPL
LTPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNGEAIPIYAEIENCSSRLVVPKAAIF
QTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGKMLKIPPVTPSILDCCIIRVYIHI
PGAKKLMLELPLVIGTIPYSGFGRRNSSMASQFSMDMCWLALALPEQPEAPPNYADVVSE
EEFSRHIPPYPQPSACDGEACYSMFACIQEFRFQPPPLYSESHAQLFCLQPVGPTNRAHF
NT seq 903 nt   +upstreamnt  +downstreamnt
atgagctcacaaagcagtatcttggttgatttcagacctttggcaacatcgtttactgga
aagtatggcagcattcagtactgtgtgagggctgttttggaacgaccccaagttccagac
cagagtgtaagaagagagctccaggttgtcagtcacgtggatgtcaacacaccaccctta
ttgactcctatgctgaagacacaggagaaaatggttggctgctggcttttcacttccggt
cccgtgtcactgagcgtcaagatcgagagaaagggctactgtaatggagaagctatccct
atctatgcagaaatagaaaattgttcatctcgcctggttgttcctaaggcagccatattc
caaacccagacatatttggctagtggaaagacaaagacagtccggcacatggttgccaat
gttcgtggaaaccacattggttctgggagtacggacacatggaatgggaagatgctgaag
atcccacctgtcactccgtccatcctggattgctgcattatcagagtatacattcacatt
cctggtgctaaaaagttgatgctggagctgcccttggttattggtacaattccctacagt
ggctttggccgcagaaacagcagtatggcaagccagttcagtatggacatgtgctggttg
gcactggccctgccggagcagcctgaagcaccaccaaattatgcagatgtggtatctgaa
gaagaattctcccgacacattcctccttatcctcagccttctgcctgtgacggggaagcc
tgctactctatgtttgcctgcatacaagaattccggtttcagcctccgcctctttattca
gagtcacatgctcagttgttttgcctgcagcctgttggtcccacgaaccgagcacacttc
tga

DBGET integrated database retrieval system